HHsearch alignment for GI: 254780810 and conserved domain: KOG0651

>KOG0651 consensus.
Probab=92.34  E-value=0.28  Score=27.57  Aligned_cols=142  Identities=22%  Similarity=0.295  Sum_probs=68.9

Q ss_pred             CCCCCCEEECCCCCCCCCCCCCEEEEEEEECCCCCCCCCCEEECCCCCCCHHHHHCCCCHHHCCCCCC-CC--CCCCCCC
Q ss_conf             66556046010000122125987999886246888763000222255688788512443000200011-22--3432477
Q gi|254780810|r   77 AGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAINFDVPERVRNKIHFDNLTPLYP-DK--RFNMELN  153 (423)
Q Consensus        77 ~~~~DiyVs~slir~f~Lr~GD~V~g~~r~~~~~~~~~~L~rV~~vnG~~~d~~~~~~~f~~l~p~~p-~~--~i~le~~  153 (423)
T Consensus        75 ~Gpryvvg~~~~~D~~~i~~G~rv~ldittltIm~--~lprevd-~vy~m~~e~~~~~s~~~~ggl~~qirelre~ielp  151 (388)
T KOG0651          75 SGPRYVVGCRRSVDKEKIARGTRVVLDITTLTIMR--GLPREVD-LVYNMSHEDPRNISFENVGGLFYQIRELREVIELP  151 (388)
T ss_pred             CCCCEEEECCCCCCHHHHCCCCEEEEEEEEEEHHC--CCCHHHH-HHHHHHHCCCCCCCHHHHCCHHHHHHHHHHHEEEE
T ss_conf             89807987255434555116741366534322230--5644778-88775415755467877178388889988655740


Q ss_pred             CCCCCCHHHHHHHHHHHHHCCCCEEEECCCCCCHHHHHHHHHHHHHHCCCCCEE---EEEECCCCHHHHHHHHHHHC
Q ss_conf             865321368889988655102312220487787899999999998611886469---99950878789999998403
Q gi|254780810|r  154 NPENKDISSRVIDLIAPIGKGQRSLIVAPPRTGKTILLQNIAHSIKKNHPECYL---IVLLIDERPEEVTDMQRSVQ  227 (423)
Q Consensus       154 ~~~p~~~~~~~id~~~pig~gqr~~i~~~~~~gkt~ll~~ia~~~~~~~~~v~~---i~~ligEr~~ev~e~~~~~~  227 (423)
T Consensus       152 l~np~-lf~r-vgIk~Pkg----~ll~GppGtGKTlla~~Vaa~mg~nfl~v~ss~lv~kyiGEsaRlIRemf~yA~  222 (388)
T KOG0651         152 LTNPE-LFLR-VGIKPPKG----LLLYGPPGTGKTLLARAVAATMGVNFLKVVSSALVDKYIGESARLIRDMFRYAR  222 (388)
T ss_pred             CCCCH-HCCC-CCCCCCCE----EEEECCCCCCHHHHHHHHHHHCCCCEEEEEHHHHHHHHCCCHHHHHHHHHHHHH
T ss_conf             24810-0234-57778825----687679998645999999986598547744766633002657889999997786