HHsearch alignment for GI: 254780810 and conserved domain: KOG0736

>KOG0736 consensus.
Probab=92.64  E-value=0.074  Score=31.32  Aligned_cols=45  Identities=31%  Similarity=0.494  Sum_probs=30.4

Q ss_pred             EEEECCCCCCHHHHHHHHHHHHHHC-----CCCCEEEEEECCCCHHHHHHHH
Q ss_conf             2220487787899999999998611-----8864699995087878999999
Q gi|254780810|r  177 SLIVAPPRTGKTILLQNIAHSIKKN-----HPECYLIVLLIDERPEEVTDMQ  223 (423)
Q Consensus       177 ~~i~~~~~~gkt~ll~~ia~~~~~~-----~~~v~~i~~ligEr~~ev~e~~  223 (423)
T Consensus       708 ILLYGPPGTGKTLlAKAVATEcsL~FlSVKGPELLNMY--VGqSE~NVR~VF  757 (953)
T KOG0736         708 ILLYGPPGTGKTLLAKAVATECSLNFLSVKGPELLNMY--VGQSEENVREVF  757 (953)
T ss_pred             EEEECCCCCCHHHHHHHHHHHCEEEEEEECCHHHHHHH--HCCHHHHHHHHH
T ss_conf             58877999855799999875430367850588998877--430188899999