HHsearch alignment for GI: 254780810 and conserved domain: KOG0745

>KOG0745 consensus.
Probab=95.94  E-value=0.022  Score=34.84  Aligned_cols=112  Identities=23%  Similarity=0.381  Sum_probs=59.9

Q ss_pred             CEEEECCCCCCHHHHHHHHHHHHHHCCCCCEEEEE-ECCCCHHHHHHHHHHHCCEEEECCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             12220487787899999999998611886469999-50878789999998403427823667888899999999999999
Q gi|254780810|r  176 RSLIVAPPRTGKTILLQNIAHSIKKNHPECYLIVL-LIDERPEEVTDMQRSVQGEVISSTFDESAARHVQVAEMVIAKAK  254 (423)
Q Consensus       176 r~~i~~~~~~gkt~ll~~ia~~~~~~~~~v~~i~~-ligEr~~ev~e~~~~~~~~vv~st~d~~~~~~~~~a~~a~~~a~  254 (423)
T Consensus       228 NvLllGPtGsGKTllaqTLAr~ldVPfaIcDcTtLTQAGYVGeDVEsvi~K-----------------------Ll~~A~  284 (564)
T KOG0745         228 NVLLLGPTGSGKTLLAQTLARVLDVPFAICDCTTLTQAGYVGEDVESVIQK-----------------------LLQEAE  284 (564)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHHCCCEEEECCCCHHHCCCCCCCHHHHHHH-----------------------HHHHCC
T ss_conf             479977888764389999999708876873255220055345429999999-----------------------999725


Q ss_pred             HHHHCCCCEEEEEECHHHHHHHHHCCCCCCCCCCCC-CCCHHHHHHCHHHHHCCCCCCCCCC
Q ss_conf             999779928999816389877620013667776777-5202466504687522577777785
Q gi|254780810|r  255 CLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTG-GVDANALQRPKRFFGAARNIKEGGS  315 (423)
Q Consensus       255 ~~~e~G~dVll~~DslTR~ArA~~~~~~~~g~~~~g-g~~~~~l~~~~~~~~~ar~~~~~Gs  315 (423)
T Consensus       285 ~nVekAQqGIVflDEvDKi~~~~~~i~--~~RDVsGEGVQQaL---LKllEGtvVnVpeK~~  341 (564)
T KOG0745         285 YNVEKAQQGIVFLDEVDKITKKAESIH--TSRDVSGEGVQQAL---LKLLEGTVVNVPEKGS  341 (564)
T ss_pred             CCHHHHHCCEEEEEHHHHHCCCCCCCC--CCCCCCCHHHHHHH---HHHHCCCEECCCCCCC
T ss_conf             789988267388760124413676545--44456626699999---9985262770267787