HHsearch alignment for GI: 254780810 and conserved domain: KOG4658

>KOG4658 consensus.
Probab=95.97  E-value=0.1  Score=30.46  Aligned_cols=100  Identities=16%  Similarity=0.215  Sum_probs=60.6

Q ss_pred             HHHHHHHHHHHCCCCEEEECCCCCCHHHHHHHHHHHH--HHCCCCCEEEEEECCC--CHHHHHHHHHHHCCEEEECCCCC
Q ss_conf             8889988655102312220487787899999999998--6118864699995087--87899999984034278236678
Q gi|254780810|r  162 SRVIDLIAPIGKGQRSLIVAPPRTGKTILLQNIAHSI--KKNHPECYLIVLLIDE--RPEEVTDMQRSVQGEVISSTFDE  237 (423)
Q Consensus       162 ~~~id~~~pig~gqr~~i~~~~~~gkt~ll~~ia~~~--~~~~~~v~~i~~ligE--r~~ev~e~~~~~~~~vv~st~d~  237 (423)
T Consensus       168 ekl~~~L~~d~~-~ivgi~GMGGvGKTTL~~qi~N~~~~v~~~Fd~~iWV~-VSk~f~~~~iq~~Il~~l~-~~~~~~~~  244 (889)
T KOG4658         168 EKLWNRLMEDDV-GIVGIYGMGGVGKTTLARQIFNKFDEVGNHFDGVIWVV-VSKEFTTRKIQQTILERLG-LLDEEWED  244 (889)
T ss_pred             HHHHHHHCCCCC-CEEEEECCCCCCHHHHHHHHHHCCHHHCCCCCEEEEEE-ECCCCCHHHHHHHHHHHHC-CCCCCCCC
T ss_conf             999998404799-68999889703499999998413312235787499999-7763108889999999844-68710001


Q ss_pred             CHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHH
Q ss_conf             8889999999999999999977992899981638
Q gi|254780810|r  238 SAARHVQVAEMVIAKAKCLVEYGLDVVILLDSIT  271 (423)
Q Consensus       238 ~~~~~~~~a~~a~~~a~~~~e~G~dVll~~DslT  271 (423)
T Consensus       245 ~~~-----~~~~~~i~~~L~--~krfllvLDDIW  271 (889)
T KOG4658         245 KEE-----DELASKLLNLLE--GKRFLLVLDDIW  271 (889)
T ss_pred             CCH-----HHHHHHHHHHHC--CCCEEEEEECCC
T ss_conf             028-----899999999855--685599982567