HHsearch alignment for GI: 254780810 and conserved domain: PRK02118

>PRK02118 V-type ATP synthase subunit B; Provisional.
Probab=100.00  E-value=0  Score=473.70  Aligned_cols=318  Identities=16%  Similarity=0.100  Sum_probs=289.0

Q ss_pred             CCCCCCCCCEEECCCCCCCCCCCCCEEEEEEEECCCCCCCCCCEEECCCCCCCHHHHHCCCCHHHCCCCCCCCCCCCCCC
Q ss_conf             86666556046010000122125987999886246888763000222255688788512443000200011223432477
Q gi|254780810|r   74 NYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAINFDVPERVRNKIHFDNLTPLYPDKRFNMELN  153 (423)
Q Consensus        74 ~yl~~~~DiyVs~slir~f~Lr~GD~V~g~~r~~~~~~~~~~L~rV~~vnG~~~d~~~~~~~f~~l~p~~p~~~i~le~~  153 (423)
T Consensus        41 EVI~~~~d~v~iqvfe~T~Gi~~G~~V~~tG~~l~V~vg~~lLGRV~DglGrPiDggp~~~~-~~~~i~~~~inP~~R~~  119 (432)
T PRK02118         41 SVLKLDGDKVTLQVFGGTSGISTGDEVVFLGRPMQVTFSDNLLGRRFNGTGKPIDGGPELEG-EPIEIGGPSVNPVKRIV  119 (432)
T ss_pred             EEEEEECCEEEEEECCCCCCCCCCCEEEECCCCCEEEECHHHCCCEECCCCCCCCCCCCCCC-CEEECCCCCCCCHHHCC
T ss_conf             99998199899998469878999999996899767882865437864476761589987889-88613699989642068


Q ss_pred             CCCCCCHHHHHHHHHHHHHCCCCEEEECCCCCCHHHHHHHHHHHHHHCCCCCEEEEEECCCCHHHHHHHHHHH-------
Q ss_conf             8653213688899886551023122204877878999999999986118864699995087878999999840-------
Q gi|254780810|r  154 NPENKDISSRVIDLIAPIGKGQRSLIVAPPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSV-------  226 (423)
Q Consensus       154 ~~~p~~~~~~~id~~~pig~gqr~~i~~~~~~gkt~ll~~ia~~~~~~~~~v~~i~~ligEr~~ev~e~~~~~-------  226 (423)
T Consensus       120 p~e~l~TGI~aID~l~~l~rGQKi~IFsgsG~gks~L~~~Ia~~a~~d----vvV~~~iGer~~e~~~f~~~~~~~~~l~  195 (432)
T PRK02118        120 PREMIRTGIPMIDVFNTLVKSQKIPIFSSSGEPYNALLARIALQAEAD----IIILGGMGLTFDDYLFFKDEFEKAGALD  195 (432)
T ss_pred             CCCCCCCCCEEEECCCCCCCCCEEEEECCCCCCHHHHHHHHHHHCCCC----EEEEECCEEECHHHHHHHHHHHHCCCCC
T ss_conf             876778896785423674058569874479997639999998853899----8964033244125899999875068777


Q ss_pred             CCEEEECCCCCCHHHHHHHHHHHHHHHHHHH-HCCCCEEEEEECHHHHHHHHHCCCCCCCCCCC-CCCCHHHHHHCHHHH
Q ss_conf             3427823667888899999999999999999-77992899981638987762001366777677-752024665046875
Q gi|254780810|r  227 QGEVISSTFDESAARHVQVAEMVIAKAKCLV-EYGLDVVILLDSITRLCRAYNVLMPSSGKILT-GGVDANALQRPKRFF  304 (423)
Q Consensus       227 ~~~vv~st~d~~~~~~~~~a~~a~~~a~~~~-e~G~dVll~~DslTR~ArA~~~~~~~~g~~~~-gg~~~~~l~~~~~~~  304 (423)
T Consensus       196 rtvlv~~ts~~p~~~R~~~~~~altiAEyfr~d~G~~VLli~DdlTr~A~A~REIs~~~ge~P~r~GYP~~l~s~La~l~  275 (432)
T PRK02118        196 RTVMFVHTAVDPPVECLLVPDMALAVAEKFAVEEGKKVLVLLTDMTNFADALKEISITMDQIPSNRGYPGSLYSDLAKRY  275 (432)
T ss_pred             EEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHH
T ss_conf             07998347778989987788888889999987459729999766788777887898754899987786953999999999


Q ss_pred             HCCCCCCCCCCCEEEEEEEECCCCCCCCHHHHHHHHCCCCEEEEEHHHHHCCCCCCCCCCCCCCCCHHHCCC----HHHH
Q ss_conf             225777777850012112012676554138898852266078980878847999740533542210155199----9999
Q gi|254780810|r  305 GAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDIIKSGTRKEDLLVE----RQDL  380 (423)
Q Consensus       305 ~~ar~~~~~Gs~T~~~t~lvetg~~~d~~i~~~~~~~~d~~i~L~r~la~~~~~PAId~~~S~sR~~~~l~~----~~~~  380 (423)
T Consensus       276 ERAg~~~~~GSIT~i~~v~~p-~dD~t~Pi~d~t~~ItdGqIvLsr~--------~id~l~SlSRl~~~~ig~~tr~dh~  346 (432)
T PRK02118        276 EKAVDFADGGSITIIAVTTMP-GDDITHPVPDNTGYITEGQFYLKRG--------RIDPFGSLSRLKQLVIGKKTREDHG  346 (432)
T ss_pred             HHCCCCCCCEEEEEEEEEECC-CCCCCCCHHHHHHHHHCCEEEEECC--------CCCCCCCHHHHHHCCCCCCCHHHHH
T ss_conf             834689998026899999757-8777775688999985776885068--------7576443777765656542499999


Q ss_pred             HHHHHHHHHHHCCCCHHHHHHHHHH
Q ss_conf             9999999996126937899999998
Q gi|254780810|r  381 QKVFMLRRIVSSMNSSDAIEFLIDK  405 (423)
Q Consensus       381 ~~~~~~r~~l~~~~~~e~~~~l~~~  405 (423)
T Consensus       347 ~~~~~l~~~ya~~~~~~~~~~~~~~  371 (432)
T PRK02118        347 DLMNAMIRLYADSRKAKEKMAMGFK  371 (432)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             9999999999865579999999764