HHsearch alignment for GI: 254780810 and conserved domain: PRK05595

>PRK05595 replicative DNA helicase; Provisional.
Probab=94.40  E-value=0.1  Score=30.48  Aligned_cols=62  Identities=26%  Similarity=0.297  Sum_probs=43.2

Q ss_pred             CCCHHHHHHHHHHH-HHCCCCEEEECCCCCCHHHHHHHHHHHHHHCCCCCEEEEEECCCCHHHH
Q ss_conf             32136888998865-5102312220487787899999999998611886469999508787899
Q gi|254780810|r  157 NKDISSRVIDLIAP-IGKGQRSLIVAPPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEV  219 (423)
Q Consensus       157 p~~~~~~~id~~~p-ig~gqr~~i~~~~~~gkt~ll~~ia~~~~~~~~~v~~i~~ligEr~~ev  219 (423)
T Consensus       183 Gi~TGf~~LD~~t~Gl~~GdLiiiaaRP~mGKTa~alnia~~~a~~~g~~V~~f-SlEMs~~ql  245 (444)
T PRK05595        183 GVASGFRELDAKTSGFQKGDMILIAARPSMGKTTFALNIAEYAALREGKSVVIF-SLEMSKEQL  245 (444)
T ss_pred             CCCCCHHHHHHHHCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEE-ECCCCHHHH
T ss_conf             765884769987459985777999857989807999999999998669937999-588999999