HHsearch alignment for GI: 254780810 and conserved domain: PRK05636

>PRK05636 replicative DNA helicase; Provisional.
Probab=93.30  E-value=0.21  Score=28.35  Aligned_cols=64  Identities=16%  Similarity=0.254  Sum_probs=44.2

Q ss_pred             CCCCHHHHHHHHHHH-HHCCCCEEEECCCCCCHHHHHHHHHHHHHHCCCCCEEEEEECCCCHHHHH
Q ss_conf             532136888998865-51023122204877878999999999986118864699995087878999
Q gi|254780810|r  156 ENKDISSRVIDLIAP-IGKGQRSLIVAPPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVT  220 (423)
Q Consensus       156 ~p~~~~~~~id~~~p-ig~gqr~~i~~~~~~gkt~ll~~ia~~~~~~~~~v~~i~~ligEr~~ev~  220 (423)
T Consensus       248 ~Gi~TGf~~LD~~t~Gl~~G~LiIiAARPsmGKTalAlnia~n~A~~~g~~v~~f-SLEMs~~ql~  312 (507)
T PRK05636        248 TGIPTGFKDLDDLTNGLRGGQMIIVAARPGVGKSTIALDFMRSASIKNNKASVIF-SLEMSKSEIV  312 (507)
T ss_pred             EEEECCCHHHHHHHCCCCCCCEEEEEECCCCCHHHHHHHHHHHHHHHCCCCEEEE-ECCCCHHHHH
T ss_conf             2565880889975508883567999737878668999999999998769937997-1569989999