HHsearch alignment for GI: 254780810 and conserved domain: PRK06526

>PRK06526 transposase; Provisional.
Probab=95.79  E-value=0.06  Score=31.96  Aligned_cols=44  Identities=16%  Similarity=0.181  Sum_probs=33.2

Q ss_pred             HHHHHHHHHHHHHCCCCEEEECCCCCCHHHHHHHHHHHHHHCCC
Q ss_conf             36888998865510231222048778789999999999861188
Q gi|254780810|r  160 ISSRVIDLIAPIGKGQRSLIVAPPRTGKTILLQNIAHSIKKNHP  203 (423)
Q Consensus       160 ~~~~~id~~~pig~gqr~~i~~~~~~gkt~ll~~ia~~~~~~~~  203 (423)
T Consensus        84 ~~i~~La~~~fi~~~~Nvil~G~~GtGKThLA~Alg~~A~~~G~  127 (254)
T PRK06526         84 DTIAHLGTLDFVTGKENVVFLGPPGTGKTHLAIGLGIRACQAGH  127 (254)
T ss_pred             HHHHHHHCCCHHHCCCCEEEECCCCCCHHHHHHHHHHHHHHCCC
T ss_conf             99999863717765887899899998689999999999998699