HHsearch alignment for GI: 254780810 and conserved domain: PRK07773

>PRK07773 replicative DNA helicase; Validated.
Probab=91.98  E-value=0.47  Score=26.04  Aligned_cols=53  Identities=23%  Similarity=0.247  Sum_probs=42.5

Q ss_pred             CCCHHHHHHHHHHH-HHCCCCEEEECCCCCCHHHHHHHHHHHHHHCCCCCEEEE
Q ss_conf             32136888998865-510231222048778789999999999861188646999
Q gi|254780810|r  157 NKDISSRVIDLIAP-IGKGQRSLIVAPPRTGKTILLQNIAHSIKKNHPECYLIV  209 (423)
Q Consensus       157 p~~~~~~~id~~~p-ig~gqr~~i~~~~~~gkt~ll~~ia~~~~~~~~~v~~i~  209 (423)
T Consensus       185 GvpTG~~~ld~~~~g~~~~~l~i~a~rp~~GKt~~~~~~a~~~a~~~~~~v~~F  238 (868)
T PRK07773        185 GVPTGFYDLDEMTNGLHPGQMIIVAARPGVGKSTLGLDFARSCSIRHRLASVIF  238 (868)
T ss_pred             CCCCCHHHHHHHHCCCCCCCEEEEEECCCCCHHHHHHHHHHHHHHHCCCCEEEE
T ss_conf             868897999876318887767999828977777899999999998659965897