HHsearch alignment for GI: 254780810 and conserved domain: PRK08058

>PRK08058 DNA polymerase III subunit delta'; Validated.
Probab=92.11  E-value=0.2  Score=28.50  Aligned_cols=55  Identities=18%  Similarity=0.236  Sum_probs=34.6

Q ss_pred             HHCC-CCEEEECCCCCCHHHHHHHHHHHHHH---------------------CCCCCEEEEEECCC--CHHHHHHHHHHH
Q ss_conf             5102-31222048778789999999999861---------------------18864699995087--878999999840
Q gi|254780810|r  171 IGKG-QRSLIVAPPRTGKTILLQNIAHSIKK---------------------NHPECYLIVLLIDE--RPEEVTDMQRSV  226 (423)
Q Consensus       171 ig~g-qr~~i~~~~~~gkt~ll~~ia~~~~~---------------------~~~~v~~i~~ligE--r~~ev~e~~~~~  226 (423)
T Consensus        24 ~~rl~HA~Lf~Gp~G~GK~~~A~~~A~~LlC~~~~~~~~Cg~C~~C~~~~~~~HPD~~~i~p-~~~~i~idqiR~L~~~~  102 (329)
T PRK08058         24 KNRLAHAYLFEGAKGTGKKATALWLAKSLFCLERNGVEPCGTCTNCKRIESGNHPDVHLVAP-DGQSIKKDQIRYLKEEF  102 (329)
T ss_pred             CCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHCCCCCCEEEECC-CCCCCCHHHHHHHHHHH
T ss_conf             59966156557899988999999999997399999999887888999987699997677456-61407799999999996