HHsearch alignment for GI: 254780810 and conserved domain: PRK08082

>PRK08082 consensus.
Probab=94.05  E-value=0.14  Score=29.55  Aligned_cols=45  Identities=20%  Similarity=0.318  Sum_probs=37.2

Q ss_pred             CCCHHHHHHHHHHH-HHCCCCEEEECCCCCCHHHHHHHHHHHHHHC
Q ss_conf             32136888998865-5102312220487787899999999998611
Q gi|254780810|r  157 NKDISSRVIDLIAP-IGKGQRSLIVAPPRTGKTILLQNIAHSIKKN  201 (423)
Q Consensus       157 p~~~~~~~id~~~p-ig~gqr~~i~~~~~~gkt~ll~~ia~~~~~~  201 (423)
T Consensus       185 Gi~TGf~~LD~lt~G~~~g~LiviaaRPsmGKTa~alnia~~~a~~  230 (453)
T PRK08082        185 GIPTGFTELDRMTAGFQRNDLIIVAARPSVGKTAFALNIAQNVATK  230 (453)
T ss_pred             CCCCCHHHHHHHHCCCCCCCEEEEEECCCCCHHHHHHHHHHHHHHH
T ss_conf             5548848888641477758579998678875789999999999985