HHsearch alignment for GI: 254780810 and conserved domain: PRK08840

>PRK08840 replicative DNA helicase; Provisional.
Probab=93.05  E-value=0.22  Score=28.24  Aligned_cols=59  Identities=17%  Similarity=0.205  Sum_probs=41.3

Q ss_pred             CCCHHHHHHHHHHH-HHCCCCEEEECCCCCCHHHHHHHHHHHHHHCCCCCEEEEEECCCCHH
Q ss_conf             32136888998865-51023122204877878999999999986118864699995087878
Q gi|254780810|r  157 NKDISSRVIDLIAP-IGKGQRSLIVAPPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPE  217 (423)
Q Consensus       157 p~~~~~~~id~~~p-ig~gqr~~i~~~~~~gkt~ll~~ia~~~~~~~~~v~~i~~ligEr~~  217 (423)
T Consensus       199 Gi~TG~~~LD~~~~Gl~~G~LiviaaRPsmGKTalalnia~n~a~~~~~~v~~f--SlEMs~  258 (464)
T PRK08840        199 GVSTGFTDLNKKTAGLQGSDLIIVAARPSMGKTTFAMNLCENAAMDQDKPVLIF--SLEMPA  258 (464)
T ss_pred             CCCCCHHHHHHHCCCCCCCCEEEEEECCCCCHHHHHHHHHHHHHHHCCCCEEEE--CCCCCH
T ss_conf             688898999875369875767999837987368999999999999659967997--677998