HHsearch alignment for GI: 254780810 and conserved domain: PRK08903

>PRK08903 hypothetical protein; Validated.
Probab=94.48  E-value=0.16  Score=29.14  Aligned_cols=51  Identities=14%  Similarity=0.104  Sum_probs=33.7

Q ss_pred             CCHHHHHHHHHHHHHCCCC-EEEECCCCCCHHHHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             2136888998865510231-2220487787899999999998611886469999
Q gi|254780810|r  158 KDISSRVIDLIAPIGKGQR-SLIVAPPRTGKTILLQNIAHSIKKNHPECYLIVL  210 (423)
Q Consensus       158 ~~~~~~~id~~~pig~gqr-~~i~~~~~~gkt~ll~~ia~~~~~~~~~v~~i~~  210 (423)
T Consensus        25 n~~~~~~l~~~~~~~~~~~~l~i~G~~G~GKTHLl~a~~~~~~~~~~~--~~yl   76 (227)
T PRK08903         25 NAELVTRLRELAAGPVADRFFYLWGEAGSGRSHLLQALVAAASEGGKN--ARYL   76 (227)
T ss_pred             HHHHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCC--EEEE
T ss_conf             599999999887438878669998999998889999999999806997--4996