HHsearch alignment for GI: 254780810 and conserved domain: PRK08939

>PRK08939 primosomal protein DnaI; Reviewed.
Probab=93.48  E-value=0.18  Score=28.83  Aligned_cols=59  Identities=20%  Similarity=0.251  Sum_probs=37.9

Q ss_pred             HHHHHHHHHHHHCCCCEEEECCCCCCHHHHHHHHHHHHHHCCCCCEEEEEECCCCHHHHHHHHHHHCC
Q ss_conf             68889988655102312220487787899999999998611886469999508787899999984034
Q gi|254780810|r  161 SSRVIDLIAPIGKGQRSLIVAPPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQG  228 (423)
Q Consensus       161 ~~~~id~~~pig~gqr~~i~~~~~~gkt~ll~~ia~~~~~~~~~v~~i~~ligEr~~ev~e~~~~~~~  228 (423)
T Consensus       144 a~~F~~~y~~~~~~kGlyl~G~~G~GKTyL~~aian~La~~g~~v~~v~---------~p~~~~~lK~  202 (306)
T PRK08939        144 ALDFLEAYKPGEKVKGLYLYGDFGVGKTYLLAAIANELAKKGVSSTLVH---------FPEFIRELKN  202 (306)
T ss_pred             HHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEE---------HHHHHHHHHH
T ss_conf             9999997376988877889899999899999999999998699299987---------5999999999