HHsearch alignment for GI: 254780810 and conserved domain: PRK09376

>PRK09376 rho transcription termination factor Rho; Provisional.
Probab=100.00  E-value=0  Score=1017.36  Aligned_cols=416  Identities=71%  Similarity=1.109  Sum_probs=411.7

Q ss_pred             CCCHHHHHCCCHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEEEEEEECCCCEEEEECCCCCCCCCCCC
Q ss_conf             54879997099899999999838988576667899999998752058748999998540477026750454866665560
Q gi|254780810|r    3 EMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQDGFGFLRSPDANYLAGPDDI   82 (423)
Q Consensus         3 ~m~l~eL~~~~l~EL~eiAkelgIe~~~~l~K~eLI~~Il~~~~~~~g~~~~eGvLEIl~dGyGFLR~~~~~yl~~~~Di   82 (423)
T Consensus         1 ~~~i~eL~~~~l~eL~~iA~~lgI~~~~~~~K~eLI~~Ilk~~a~~~~~i~~~GvLEi~~dGyGFLR~~~~nylp~~dDi   80 (416)
T PRK09376          1 MMNLSELKNKTLSELLELAEELGIENASRLRKQELIFAILKAQAEKGEDIFGEGVLEILPDGFGFLRSPDANYLPGPDDI   80 (416)
T ss_pred             CCCHHHHHCCCHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEEEEEECCCCCEEEECCCCCCCCCCCCE
T ss_conf             98679973699999999999859987677899999999999998528958767999964898657057876888998883


Q ss_pred             EEECCCCCCCCCCCCCEEEEEEEECCCCCCCCCCEEECCCCCCCHHHHHCCCCHHHCCCCCCCCCCCCCCCCCCCCCHHH
Q ss_conf             46010000122125987999886246888763000222255688788512443000200011223432477865321368
Q gi|254780810|r   83 YVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISS  162 (423)
Q Consensus        83 yVs~slir~f~Lr~GD~V~g~~r~~~~~~~~~~L~rV~~vnG~~~d~~~~~~~f~~l~p~~p~~~i~le~~~~~p~~~~~  162 (423)
T Consensus        81 YVS~sqIrrf~LR~GD~V~G~vR~pke~Ery~aLl~V~~VNg~~pe~~~~r~~F~~LTPi~P~erl~LE~~---~~~~s~  157 (416)
T PRK09376         81 YVSPSQIRRFNLRTGDTVEGKIRPPKEGERYFALLKVETVNGEDPEKARNRILFENLTPLYPNERLKLETG---TEDLST  157 (416)
T ss_pred             EECHHHHHHHCCCCCCEEEEEEECCCCCCCCCCEEEEEECCCCCHHHHCCCCCCCCCCCCCCHHHHCCCCC---CCCCCC
T ss_conf             36899999809988888999886898888774337763228939899657354014877797223114568---876540


Q ss_pred             HHHHHHHHHHCCCCEEEECCCCCCHHHHHHHHHHHHHHCCCCCEEEEEECCCCHHHHHHHHHHHCCEEEECCCCCCHHHH
Q ss_conf             88998865510231222048778789999999999861188646999950878789999998403427823667888899
Q gi|254780810|r  163 RVIDLIAPIGKGQRSLIVAPPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARH  242 (423)
Q Consensus       163 ~~id~~~pig~gqr~~i~~~~~~gkt~ll~~ia~~~~~~~~~v~~i~~ligEr~~ev~e~~~~~~~~vv~st~d~~~~~~  242 (423)
T Consensus       158 RiiDL~aPIGkGQRgLIVAPPkaGKT~lLq~IA~aI~~N~Pe~~liVLLIDERPEEVTdm~r~v~~eV~aStfD~~~~~H  237 (416)
T PRK09376        158 RVIDLVAPIGKGQRGLIVAPPKAGKTVLLQNIANSITTNHPEVHLIVLLIDERPEEVTDMQRSVKGEVVASTFDEPAERH  237 (416)
T ss_pred             CCEEEECCCCCCCCCEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEEEEECCCCHHHHHHHHHCCEEEEEECCCCCHHHH
T ss_conf             02110054135850037569987547999999999985699719999990489347778775046189997799987899


Q ss_pred             HHHHHHHHHHHHHHHHCCCCEEEEEECHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHCHHHHHCCCCCCCCCCCEEEEEE
Q ss_conf             99999999999999977992899981638987762001366777677752024665046875225777777850012112
Q gi|254780810|r  243 VQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRFFGAARNIKEGGSLTIIGTA  322 (423)
Q Consensus       243 ~~~a~~a~~~a~~~~e~G~dVll~~DslTR~ArA~~~~~~~~g~~~~gg~~~~~l~~~~~~~~~ar~~~~~Gs~T~~~t~  322 (423)
T Consensus       238 ~~vae~~lerAkRlvE~G~DVvillDSiTRLaRAyN~~~~~sGr~lsGG~D~~Al~~PKrfFGAARnie~GGSLTIiaTa  317 (416)
T PRK09376        238 VQVAEMVIEKAKRLVEHGKDVVILLDSITRLARAYNTVVPSSGKVLSGGVDANALHRPKRFFGAARNIEEGGSLTIIATA  317 (416)
T ss_pred             HHHHHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHCCCCCCCCCCCCCCCHHHHCCCHHHHHHHCCCCCCCCHHHHHHH
T ss_conf             99999999999999876997899973157888886234699877544765777760556764100267767517787777


Q ss_pred             EECCCCCCCCHHHHHHHHCCCCEEEEEHHHHHCCCCCCCCCCCCCCCCHHHCCCHHHHHHHHHHHHHHHCCCCHHHHHHH
Q ss_conf             01267655413889885226607898087884799974053354221015519999999999999996126937899999
Q gi|254780810|r  323 LVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFL  402 (423)
Q Consensus       323 lvetg~~~d~~i~~~~~~~~d~~i~L~r~la~~~~~PAId~~~S~sR~~~~l~~~~~~~~~~~~r~~l~~~~~~e~~~~l  402 (423)
T Consensus       318 LveTgSrMDdvIfeEfkgTgNmEl~Ldr~la~~RifPAIdi~~SgTRkEelLl~~~e~~~~~~lRr~l~~~~~~ea~e~l  397 (416)
T PRK09376        318 LIDTGSRMDEVIFEEFKGTGNMELHLDRKLAEKRIFPAIDINRSGTRKEELLLSPEELQKVWILRKILSPMDEVEAMEFL  397 (416)
T ss_pred             HHCCCCCHHHHHHHHHCCCCCEEEEECHHHHHCCCCCCCCCCCCCCCHHHHCCCHHHHHHHHHHHHHHHCCCHHHHHHHH
T ss_conf             75268625389999851578459998766775788640133357772576537999999999999987159979999999


Q ss_pred             HHHHHCCCCHHHHHHHHHC
Q ss_conf             9984028998999986430
Q gi|254780810|r  403 IDKLKQTKDNKDFFYSMNK  421 (423)
Q Consensus       403 ~~~~~~~~~n~e~l~~~~k  421 (423)
T Consensus       398 ~~~l~~t~~N~efl~~~~~  416 (416)
T PRK09376        398 LDKLKKTKTNEEFFDSMNR  416 (416)
T ss_pred             HHHHHCCCCHHHHHHHHCC
T ss_conf             9998628989999998439