HHsearch alignment for GI: 254780810 and conserved domain: PRK09493

>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed.
Probab=95.31  E-value=0.018  Score=35.34  Aligned_cols=57  Identities=18%  Similarity=0.273  Sum_probs=34.7

Q ss_pred             HHHHCCCCEEEECCCCCCHHHHHHHHHHHHHHCCCCCEEEEEECCCCHHHHHHHHHH
Q ss_conf             655102312220487787899999999998611886469999508787899999984
Q gi|254780810|r  169 APIGKGQRSLIVAPPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRS  225 (423)
Q Consensus       169 ~pig~gqr~~i~~~~~~gkt~ll~~ia~~~~~~~~~v~~i~~ligEr~~ev~e~~~~  225 (423)
T Consensus        22 ~~i~~Ge~~~liG~nGsGKSTll~~i~Gl~~~~~G~i~~~G~~i~~~~~~~~~~r~~   78 (240)
T PRK09493         22 LNIDQGEVVVIIGPSGSGKSTLLRCINKLEEITSGDLIVDGLKVNDPKVDERLIRQE   78 (240)
T ss_pred             EEECCCCEEEEECCCCCHHHHHHHHHHCCCCCCCCEEEECCEECCCCCHHHHHHHHH
T ss_conf             898799899999999980999999996389999974878999878876658998752