HHsearch alignment for GI: 254780810 and conserved domain: PRK10070

>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional.
Probab=95.12  E-value=0.013  Score=36.37  Aligned_cols=105  Identities=16%  Similarity=0.196  Sum_probs=55.3

Q ss_pred             EECCCCCCCHHHHHCCCCHHHCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEECCCCCCHHHHHHHHHHH
Q ss_conf             22225568878851244300020001122343247786532136888998865510231222048778789999999999
Q gi|254780810|r  118 KVNAINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPPRTGKTILLQNIAHS  197 (423)
Q Consensus       118 rV~~vnG~~~d~~~~~~~f~~l~p~~p~~~i~le~~~~~p~~~~~~~id~~~pig~gqr~~i~~~~~~gkt~ll~~ia~~  197 (423)
T Consensus         9 ~l~kvfg~~~~~a~~~~~~g-----~~k~ei~~~tg------~~vAv~dVsl~I~~GEi~~ivG~SGsGKSTLlr~i~gL   77 (400)
T PRK10070          9 NLYKIFGEHPQRAFKYIEQG-----LSKEQILEKTG------LSLGVKDASLAIEEGEIFVIMGLSGSGKSTMVRLLNRL   77 (400)
T ss_pred             EEEEECCCCHHHHHHHHHCC-----CCHHHHHHHHC------CEEEEECCEEEECCCCEEEEECCCCCHHHHHHHHHHCC
T ss_conf             47993298989999998769-----99899998649------99989740768879999999999984699999999759


Q ss_pred             HHHCCCCCEEEEE-ECCCCHHHHHHHHHHHCCEEEEC
Q ss_conf             8611886469999-50878789999998403427823
Q gi|254780810|r  198 IKKNHPECYLIVL-LIDERPEEVTDMQRSVQGEVISS  233 (423)
Q Consensus       198 ~~~~~~~v~~i~~-ligEr~~ev~e~~~~~~~~vv~s  233 (423)
T Consensus        78 ~~Pt~G~I~i~G~di~~~~~~~l~~~rrr~igmVFQ~  114 (400)
T PRK10070         78 IEPTRGQVLIDGVDIAKISDAELREVRRKKIAMVFQS  114 (400)
T ss_pred             CCCCCCEEEECCEECCCCCHHHHHHHHCCCEEEEECC
T ss_conf             9989818999999999899789876514655999579