HHsearch alignment for GI: 254780810 and conserved domain: PRK10938

>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional.
Probab=94.48  E-value=0.025  Score=34.40  Aligned_cols=30  Identities=33%  Similarity=0.430  Sum_probs=26.1

Q ss_pred             HHHHHHCCCCEEEECCCCCCHHHHHHHHHH
Q ss_conf             886551023122204877878999999999
Q gi|254780810|r  167 LIAPIGKGQRSLIVAPPRTGKTILLQNIAH  196 (423)
Q Consensus       167 ~~~pig~gqr~~i~~~~~~gkt~ll~~ia~  196 (423)
T Consensus       279 vs~~v~~GE~~~i~G~nGsGKSTLl~~l~G  308 (490)
T PRK10938        279 LSWQVNPGEHWQIVGPNGAGKSTLLSLITG  308 (490)
T ss_pred             EEEEECCCCEEEEECCCCCCHHHHHHHHHC
T ss_conf             578983898899986788879999999808