HHsearch alignment for GI: 254780810 and conserved domain: PRK11022

>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional.
Probab=93.46  E-value=0.052  Score=32.36  Aligned_cols=38  Identities=21%  Similarity=0.285  Sum_probs=29.5

Q ss_pred             HHHHH-HHHHHHCCCCEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             88899-886551023122204877878999999999986
Q gi|254780810|r  162 SRVID-LIAPIGKGQRSLIVAPPRTGKTILLQNIAHSIK  199 (423)
Q Consensus       162 ~~~id-~~~pig~gqr~~i~~~~~~gkt~ll~~ia~~~~  199 (423)
T Consensus        20 v~Av~~Vsf~i~~GEilgivGeSGsGKSTl~~~ilgll~   58 (327)
T PRK11022         20 FKAVDRISYSVKQGEVVGIVGESGSGKSVSSLAIMGLID   58 (327)
T ss_pred             EEEEECEEEEECCCCEEEEECCCCCHHHHHHHHHHCCCC
T ss_conf             999844187988999999999998789999999974889