HHsearch alignment for GI: 254780810 and conserved domain: PRK12422

>PRK12422 chromosomal replication initiation protein; Provisional.
Probab=94.95  E-value=0.13  Score=29.72  Aligned_cols=34  Identities=18%  Similarity=0.337  Sum_probs=27.7

Q ss_pred             CEEEECCCCCCHHHHHHHHHHHHHHCCCCCEEEEEE
Q ss_conf             122204877878999999999986118864699995
Q gi|254780810|r  176 RSLIVAPPRTGKTILLQNIAHSIKKNHPECYLIVLL  211 (423)
Q Consensus       176 r~~i~~~~~~gkt~ll~~ia~~~~~~~~~v~~i~~l  211 (423)
T Consensus       143 PLfIyG~~GlGKTHLL~AIgn~i~~--~~~kV~Yvt  176 (455)
T PRK12422        143 PIYLFGPEGSGKTHLMQAAVSALRE--SGGKILYVS  176 (455)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHHHC--CCCEEEEEC
T ss_conf             7588789999789999999998537--998699974