HHsearch alignment for GI: 254780810 and conserved domain: PRK13764

>PRK13764 ATPase; Provisional.
Probab=93.36  E-value=0.11  Score=30.32  Aligned_cols=67  Identities=19%  Similarity=0.298  Sum_probs=40.5

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCC-EEEECCCCCCHHHHHHHHHHHHHHCCCCCEEEEEECCCCHH
Q ss_conf             20001122343247786532136888998865510231-22204877878999999999986118864699995087878
Q gi|254780810|r  139 LTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQR-SLIVAPPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPE  217 (423)
Q Consensus       139 l~p~~p~~~i~le~~~~~p~~~~~~~id~~~pig~gqr-~~i~~~~~~gkt~ll~~ia~~~~~~~~~v~~i~~ligEr~~  217 (423)
T Consensus       231 ITaVRPv~~~sled-----Y~l~~~l~~---Rl~~~a~GilIaG~PGaGKsTfaqalA~~~~~~g~iVK-----TmEsPR  297 (605)
T PRK13764        231 ITAVRPIVKLSLED-----YNLSEKLKE---RLEERAEGILIAGAPGAGKSTFAQALAEFYADMGKIVK-----TMESPR  297 (605)
T ss_pred             EEEEEEEEECCHHH-----CCCCHHHHH---HHHHCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCEEE-----ECCCCC
T ss_conf             99971017804777-----167899999---88733664999779999778999999999984797898-----324862


Q ss_pred             H
Q ss_conf             9
Q gi|254780810|r  218 E  218 (423)
Q Consensus       218 e  218 (423)
T Consensus       298 D  298 (605)
T PRK13764        298 D  298 (605)
T ss_pred             C
T ss_conf             3