HHsearch alignment for GI: 254780810 and conserved domain: PTZ00035

>PTZ00035 Rad51; Provisional.
Probab=94.55  E-value=0.37  Score=26.78  Aligned_cols=115  Identities=17%  Similarity=0.248  Sum_probs=68.1

Q ss_pred             CCCHHHHHHHHHHHHH--CCCCEEEECCCCCCHHHHHHHHHHHHHH----CCCCCEEEEE-ECC-CCHHHHHHHHHHH--
Q ss_conf             3213688899886551--0231222048778789999999999861----1886469999-508-7878999999840--
Q gi|254780810|r  157 NKDISSRVIDLIAPIG--KGQRSLIVAPPRTGKTILLQNIAHSIKK----NHPECYLIVL-LID-ERPEEVTDMQRSV--  226 (423)
Q Consensus       157 p~~~~~~~id~~~pig--~gqr~~i~~~~~~gkt~ll~~ia~~~~~----~~~~v~~i~~-lig-Er~~ev~e~~~~~--  226 (423)
T Consensus       111 ~itTGs~~LD~LLGGGiet~sITEi~Ge~gsGKTQlChqLaV~~QLP~~~GG~~GkvvYIDTEgtFrpeRi~qIA~~~gl  190 (350)
T PTZ00035        111 KFTTGSKQLDRLLKGGIETGGITELFGEFRTGKSQLCHTLAITCQLPIEQSGGEGKCLWIDTEGTFRPERIVAIAKRYGL  190 (350)
T ss_pred             EECCCCHHHHHHHCCCEECCCEEEEEECCCCCHHHHHHHHHHHCCCCHHHCCCCCCEEEEECCCCCCHHHHHHHHHHCCC
T ss_conf             35758578887627894138587897279897899999999990485777798862799968899878999999987099


Q ss_pred             ------CCEEEECCCCCCHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHHHHHH
Q ss_conf             ------342782366788889999999999999999977992899981638987762
Q gi|254780810|r  227 ------QGEVISSTFDESAARHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAY  277 (423)
Q Consensus       227 ------~~~vv~st~d~~~~~~~~~a~~a~~~a~~~~e~G~dVll~~DslTR~ArA~  277 (423)
T Consensus       191 d~~~vL~nI~~ara~n--~ehq~~l----l~~~~~~~~e~~vrLlIVDSitalFR~e  241 (350)
T PTZ00035        191 HPTDCLNNIAYAKAYN--CDHQTEL----LIDASAMMADARFALLIVDSATALYRSE  241 (350)
T ss_pred             CHHHHHHHEEEEEECC--HHHHHHH----HHHHHHHHHCCCEEEEEEHHHHHHHHHH
T ss_conf             9799853322322068--7889999----9999998511675899854456676654