HHsearch alignment for GI: 254780810 and conserved domain: TIGR02204

>TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein; InterPro: IPR011918 This protein is related to a Proteobacterial ATP transporter that exports lipid A and to eukaryotic P-glycoproteins ..
Probab=96.89  E-value=0.0015  Score=42.46  Aligned_cols=135  Identities=21%  Similarity=0.366  Sum_probs=78.0

Q ss_pred             HHCCCCHHHCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEECCCCCCHHHHHHHHHHHHHHCCCCCEEEE
Q ss_conf             51244300020001122343247786532136888998865510231222048778789999999999861188646999
Q gi|254780810|r  130 VRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPPRTGKTILLQNIAHSIKKNHPECYLIV  209 (423)
Q Consensus       130 ~~~~~~f~~l~p~~p~~~i~le~~~~~p~~~~~~~id~~~pig~gqr~~i~~~~~~gkt~ll~~ia~~~~~~~~~v~~i~  209 (423)
T Consensus       334 ~~Gei~F~~V~F~YP~R----------Pd~~aL~~~~--L~v~PGEtvAlVGPSGAGKSTlf~LLLRFYD---P~~G~il  398 (576)
T TIGR02204       334 VRGEIEFEQVNFAYPAR----------PDQPALDGLN--LTVRPGETVALVGPSGAGKSTLFQLLLRFYD---PQSGRIL  398 (576)
T ss_pred             CCEEEEECCCCCCCCCC----------CCCHHHCCCC--CEECCCCEEEEECCCCCHHHHHHHHHHHCCC---CCCCEEE
T ss_conf             64027761223258798----------8804232577--2562776588766887627999999986048---8876577


Q ss_pred             E----ECCCCHHHHHHHHHHH--CCEEEECCC---------CCCHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHHH
Q ss_conf             9----5087878999999840--342782366---------788889999999999999999977992899981638987
Q gi|254780810|r  210 L----LIDERPEEVTDMQRSV--QGEVISSTF---------DESAARHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLC  274 (423)
Q Consensus       210 ~----ligEr~~ev~e~~~~~--~~~vv~st~---------d~~~~~~~~~a~~a~~~a~~~~e~G~dVll~~DslTR~A  274 (423)
T Consensus       399 LDGvd~r~~dP~~lR~~~ALVpQdp~lFa~Sv~eNIRyGrpDAs~~~V~~AA~aA~-A~E-F-------------I~~LP  463 (576)
T TIGR02204       399 LDGVDIRDLDPADLRARIALVPQDPALFAASVLENIRYGRPDASDEEVEAAARAAH-AHE-F-------------ISALP  463 (576)
T ss_pred             ECCCCHHHCCCHHHHHHCCCCCCCCCCCHHCCHHHHCCCCCCCCHHHHHHHHHHHH-HHH-H-------------HHHCC
T ss_conf             46641401680878834440258864102030442135996666689999998754-101-5-------------65188


Q ss_pred             HHHHCCCCCCCCCCCCCCCH
Q ss_conf             76200136677767775202
Q gi|254780810|r  275 RAYNVLMPSSGKILTGGVDA  294 (423)
Q Consensus       275 rA~~~~~~~~g~~~~gg~~~  294 (423)
T Consensus       464 ~GY~T~LGERGv~LSGGQrQ  483 (576)
T TIGR02204       464 EGYDTYLGERGVTLSGGQRQ  483 (576)
T ss_pred             CCCCCCCCCCCCCCCCHHHH
T ss_conf             75467655443026742468