HHsearch alignment for GI: 254780810 and conserved domain: TIGR02928

>TIGR02928 TIGR02928 orc1/cdc6 family replication initiation protein; InterPro: IPR014277 This set of DNA binding proteins shows homology to the origin recognition complex subunit 1/cell division control protein 6 family in eukaryotes. The proteins in this entry are found exclusively in the archaea. Several members may be found in a genome and interact with each other..
Probab=95.31  E-value=0.13  Score=29.69  Aligned_cols=227  Identities=19%  Similarity=0.246  Sum_probs=120.9

Q ss_pred             HHCCCCCCCC--CCCCCCCCCCCCCHHHHHHHHHHHHHC-CCC---EEEECCCCCCHHHHHHHHHHHHHH--CCCCCE-E
Q ss_conf             0020001122--343247786532136888998865510-231---222048778789999999999861--188646-9
Q gi|254780810|r  137 DNLTPLYPDK--RFNMELNNPENKDISSRVIDLIAPIGK-GQR---SLIVAPPRTGKTILLQNIAHSIKK--NHPECY-L  207 (423)
Q Consensus       137 ~~l~p~~p~~--~i~le~~~~~p~~~~~~~id~~~pig~-gqr---~~i~~~~~~gkt~ll~~ia~~~~~--~~~~v~-~  207 (423)
T Consensus         6 ~~L~~dY~Pden~i~hRd---e---qI~~l~~~L~~~l~PG~~P~Ni~iYGkTGtGKT~vt~~v~~~l~~~~~~~d~~D~   79 (383)
T TIGR02928         6 DLLEPDYVPDENRIVHRD---E---QIEELAKALRPILRPGSRPSNIFIYGKTGTGKTAVTKYVMKELEEAAEDRDVRDV   79 (383)
T ss_pred             CCCCCCCCCCCCCCCCCH---H---HHHHHHHHHHHHHCCCCCCCCEEEECCCCCCHHHHHHHHHHHHHHHHHCCCCCCE
T ss_conf             237757702742466867---8---9999999988750674898725887888987889999999999998622699715


Q ss_pred             EEEECCCC-----HHHHHHHHHHHCCEEEECCCCCCHHHHHHHHHHHHHHHHHHH-HCCCCEEEEEECHHHHHHHHHCCC
Q ss_conf             99950878-----789999998403427823667888899999999999999999-779928999816389877620013
Q gi|254780810|r  208 IVLLIDER-----PEEVTDMQRSVQGEVISSTFDESAARHVQVAEMVIAKAKCLV-EYGLDVVILLDSITRLCRAYNVLM  281 (423)
Q Consensus       208 i~~ligEr-----~~ev~e~~~~~~~~vv~st~d~~~~~~~~~a~~a~~~a~~~~-e~G~dVll~~DslTR~ArA~~~~~  281 (423)
T Consensus        80 ~~~~~NC~~~~T~y~~~~~L~~~l---n~~~~~~~vP~tG~s~~~~~~~l~~~l~~~~~~~~~ivLDEiD~Lv~~~~d-~  155 (383)
T TIGR02928        80 STVYINCQILDTSYQVLVELANQL---NRRGSGEEVPTTGLSTSEVFRELYKELNRERGDSLIIVLDEIDKLVRKDDD-D  155 (383)
T ss_pred             EEEEECCCCCCCHHHHHHHHHHHH---CCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCEEEEEECCCCHHHCCCCC-C
T ss_conf             899977854684699999999985---157788889887787899999999998320188799986231022158888-8


Q ss_pred             CCCCCCCCCCCCHHHHHHCHHHHHCCCCCCCCCCCEEE----------------EEEEECCCCCCCCHHHHHHHHC----
Q ss_conf             66777677752024665046875225777777850012----------------1120126765541388988522----
Q gi|254780810|r  282 PSSGKILTGGVDANALQRPKRFFGAARNIKEGGSLTII----------------GTALVDTGSRMDEVIFEEFKGT----  341 (423)
Q Consensus       282 ~~~g~~~~gg~~~~~l~~~~~~~~~ar~~~~~Gs~T~~----------------~t~lvetg~~~d~~i~~~~~~~----  341 (423)
T Consensus       156 P---------AyS~~LY~L~Ra~~-~~~~~~-~~vgvIgISND~~f~~~Ld~RVkSsL~~eei~FpPYdA~eL~~IL~~R  224 (383)
T TIGR02928       156 P---------AYSKLLYQLSRARE-NGDLEN-AKVGVIGISNDLKFRENLDPRVKSSLCEEEIVFPPYDAEELRDILENR  224 (383)
T ss_pred             H---------HHHHHHHHHHHHHH-CCCCCC-CCEEEEEEECCCHHHHHCCCCEECCCCCCCCEECCCCHHHHHHHHHHH
T ss_conf             0---------78788534331000-357788-534899986571436445753013248740040798869999999720


Q ss_pred             -----------CCCEEEEEHHHHHCCC---CCCCCCCCC----CCCCHHHCCCHHHHHHHH
Q ss_conf             -----------6607898087884799---974053354----221015519999999999
Q gi|254780810|r  342 -----------GNSEIVLERKIADKRI---FPAMDIIKS----GTRKEDLLVERQDLQKVF  384 (423)
Q Consensus       342 -----------~d~~i~L~r~la~~~~---~PAId~~~S----~sR~~~~l~~~~~~~~~~  384 (423)
T Consensus       225 ~v~~AF~dGvl~d~VI~lcAA~aAq~hGDAR~AiDLLR~AGe~A~~~g~~~Vt~~HV~~A~  285 (383)
T TIGR02928       225 AVEKAFYDGVLDDGVIPLCAALAAQEHGDARKAIDLLRVAGEIAEREGAERVTEDHVEEAQ  285 (383)
T ss_pred             HHHHCCCCCCCCHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHH
T ss_conf             3120336885462279999998620678789999999987687531576310088899999