HHsearch alignment for GI: 254780810 and conserved domain: TIGR03496

>TIGR03496 FliI_clade1 flagellar protein export ATPase FliI. Members of this protein family are the FliI protein of bacterial flagellum systems. This protein acts to drive protein export for flagellar biosynthesis. The most closely related family is the YscN family of bacterial type III secretion systems. This model represents one (of three) segment of the FliI family tree. These have been modeled separately in order to exclude the type III secretion ATPases more effectively.
Probab=100.00  E-value=0  Score=587.25  Aligned_cols=326  Identities=23%  Similarity=0.225  Sum_probs=304.5

Q ss_pred             CCCCCCCCCEEECCCCCCCCCCCCCEEEEEEEECCCCCCCCCCEEECCCCCCCHHHHHCCCCHHHCCCCCCCCCCCCCCC
Q ss_conf             86666556046010000122125987999886246888763000222255688788512443000200011223432477
Q gi|254780810|r   74 NYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAINFDVPERVRNKIHFDNLTPLYPDKRFNMELN  153 (423)
Q Consensus        74 ~yl~~~~DiyVs~slir~f~Lr~GD~V~g~~r~~~~~~~~~~L~rV~~vnG~~~d~~~~~~~f~~l~p~~p~~~i~le~~  153 (423)
T Consensus        37 EVVgf~~~~v~l~~~~~~~Gi~~G~~V~~tg~~~~v~vg~~lLGRVid~lG~PlDg~~~~~~~~~~pi~~~~p~p~~R~~  116 (411)
T TIGR03496        37 EVVGFSGDRVLLMPLEDVEGLRPGARVFPLEGPLRLPVGDSLLGRVIDGLGRPLDGKGPLDAGERVPLYAPPINPLKRAP  116 (411)
T ss_pred             EEEEECCCEEEEEECCCCCCCCCCCEEEECCCCCEEECCHHHCCCEECCCCCCCCCCCCCCCCCEEEEECCCCCHHHCCC
T ss_conf             99997299799998668878888999997899666763876537885788876577788887845650079968143178


Q ss_pred             CCCCCCHHHHHHHHHHHHHCCCCEEEECCCCCCHHHHHHHHHHHHHHCCCCCEEEEEECCCCHHHHHHHHHHH-------
Q ss_conf             8653213688899886551023122204877878999999999986118864699995087878999999840-------
Q gi|254780810|r  154 NPENKDISSRVIDLIAPIGKGQRSLIVAPPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSV-------  226 (423)
Q Consensus       154 ~~~p~~~~~~~id~~~pig~gqr~~i~~~~~~gkt~ll~~ia~~~~~~~~~v~~i~~ligEr~~ev~e~~~~~-------  226 (423)
T Consensus       117 i~epl~TGIraID~l~pig~GQR~gIf~g~GvGKs~Ll~~ia~~~~ad----v~VialIGeR~rev~efie~~~~~~~~~  192 (411)
T TIGR03496       117 IDEPLDVGVRAINGLLTVGRGQRIGIFAGSGVGKSVLLGMMARYTEAD----VVVVGLIGERGREVKEFIEEILGEEGLA  192 (411)
T ss_pred             CCCCCCCCCEEEECCCCCCCCCEEEECCCCCCCHHHHHHHHHHCCCCC----EEEEECCCCCHHHHHHHHHHHHCCCCCC
T ss_conf             776211583466344661468631322799986779999997534898----8999532530589999999862225652


Q ss_pred             CCEEEECCCCCCHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHHHHHHHCCCCCCCCCCC-CCCCHHHHHHCHHHHH
Q ss_conf             342782366788889999999999999999977992899981638987762001366777677-7520246650468752
Q gi|254780810|r  227 QGEVISSTFDESAARHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILT-GGVDANALQRPKRFFG  305 (423)
Q Consensus       227 ~~~vv~st~d~~~~~~~~~a~~a~~~a~~~~e~G~dVll~~DslTR~ArA~~~~~~~~g~~~~-gg~~~~~l~~~~~~~~  305 (423)
T Consensus       193 ~tvvv~atsd~p~~~r~~a~~~a~aiAEyfrd~G~~VLl~~Dsltr~A~A~REisl~~ge~P~~~gyp~~vf~~l~~l~E  272 (411)
T TIGR03496       193 RSVVVAATADESPLMRLRAAFYATAIAEYFRDQGKDVLLLMDSLTRFAMAQREIALAIGEPPATKGYPPSVFAKLPRLVE  272 (411)
T ss_pred             EEEEEEECCCCCHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHH
T ss_conf             16999943889989999999999999999996699469997468899999989998737999866788538888778887


Q ss_pred             CCCCCC-CCCCCEEEEEEEECCCCCCCCHHHHHHHHCCCCEEEEEHHHHHCCCCCCCCCCCCCCCCHHHCCCHHHHHHHH
Q ss_conf             257777-7785001211201267655413889885226607898087884799974053354221015519999999999
Q gi|254780810|r  306 AARNIK-EGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDIIKSGTRKEDLLVERQDLQKVF  384 (423)
Q Consensus       306 ~ar~~~-~~Gs~T~~~t~lvetg~~~d~~i~~~~~~~~d~~i~L~r~la~~~~~PAId~~~S~sR~~~~l~~~~~~~~~~  384 (423)
T Consensus       273 Rag~~~~~~GSIT~~~~V~~~-~dD~~dpi~d~~~~ilDG~ivLsr~la~~g~yPAIdvl~S~SR~~~~~~~~~~~~~a~  351 (411)
T TIGR03496       273 RAGNGEEGKGSITAFYTVLVE-GDDQQDPIADAARAILDGHIVLSRELAEQGHYPAIDILASISRVMPDVVSPEHLQLAR  351 (411)
T ss_pred             HCCCCCCCCEEEEEEEEEECC-CCCCCCCHHHHHHHHEEEEEEECHHHHHCCCCCCCCCCCCHHHCCHHHCCHHHHHHHH
T ss_conf             436899989868773589757-9875664577656514048999398996799997186405644233216899999999


Q ss_pred             HHHHHHHCCCCHHHHHHHHH
Q ss_conf             99999612693789999999
Q gi|254780810|r  385 MLRRIVSSMNSSDAIEFLID  404 (423)
Q Consensus       385 ~~r~~l~~~~~~e~~~~l~~  404 (423)
T Consensus       352 ~~r~~la~y~e~~~li~~g~  371 (411)
T TIGR03496       352 RFKQLLSRYQENRDLISIGA  371 (411)
T ss_pred             HHHHHHHHHHHHHHHHHHHC
T ss_conf             99999999899999999747