HHsearch alignment for GI: 254780810 and conserved domain: cd01121

>cd01121 Sms Sms (bacterial radA) DNA repair protein. This protein is not related to archael radA any more than is to other RecA-like NTPases. Sms has a role in recombination and recombinational repair and is responsible for the stabilization or processing of branched DNA molecules.
Probab=96.23  E-value=0.074  Score=31.33  Aligned_cols=60  Identities=23%  Similarity=0.278  Sum_probs=44.2

Q ss_pred             CCCCHHHHHHHHHHH--HHCCCCEEEECCCCCCHHHHHHHHHHHHHHCCCCCEEEEEECCCCHHH
Q ss_conf             532136888998865--510231222048778789999999999861188646999950878789
Q gi|254780810|r  156 ENKDISSRVIDLIAP--IGKGQRSLIVAPPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEE  218 (423)
Q Consensus       156 ~p~~~~~~~id~~~p--ig~gqr~~i~~~~~~gkt~ll~~ia~~~~~~~~~v~~i~~ligEr~~e  218 (423)
T Consensus        62 ~R~~Tgi~ElDRVLGGGiVpGSvvLlgGePGIGKSTLLLQia~~la~~~~--~vLYv-SGEES~~  123 (372)
T cd01121          62 ERIPTGIEELDRVLGGGLVPGSVILIGGDPGIGKSTLLLQVAARLAKRGG--KVLYV-SGEESPE  123 (372)
T ss_pred             CCCCCCCHHHHHHHCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHCCC--CEEEE-ECHHHHH
T ss_conf             54447836665400577306717998259988688999999999986399--38998-2456789