HHsearch alignment for GI: 254780810 and conserved domain: cd02025

>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway. The reaction carried out by this enzyme is a key regulatory point in CoA biosynthesis.
Probab=93.43  E-value=0.16  Score=29.16  Aligned_cols=31  Identities=10%  Similarity=0.019  Sum_probs=22.7

Q ss_pred             EEEECCCCCCHHHHHHHHHHHHHHCCCCCEE
Q ss_conf             2220487787899999999998611886469
Q gi|254780810|r  177 SLIVAPPRTGKTILLQNIAHSIKKNHPECYL  207 (423)
Q Consensus       177 ~~i~~~~~~gkt~ll~~ia~~~~~~~~~v~~  207 (423)
T Consensus         2 IGIaG~sgSGKST~a~~l~~~l~~~~~~~~v   32 (220)
T cd02025           2 IGIAGSVAVGKSTTARVLQALLSRWPDHPNV   32 (220)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHHHCCCCCCE
T ss_conf             8978899877999999999986002699948