>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export. Among the variety of membrane-linked or extracellular polysaccharides excreted by bacteria, only capsular polysaccharides, lipopolysaccharides, and teichoic acids have been shown to be exported by ABC transporters. A typical system is made of a conserved integral membrane and an ABC. In addition to these proteins, capsular polysaccharide exporter systems require two 'accessory' proteins to perform their function: a periplasmic (E.coli) or a lipid-anchored outer membrane protein called OMA (Neisseria meningitidis and Haemophilus influenzae) and a cytoplasmic membrane protein MPA2.

Probab=94.78  E-value=0.017  Score=35.51  Aligned_cols=31  Identities=23%  Similarity=0.314  Sum_probs=27.4

Q ss_pred             HHHHHCCCCEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             8655102312220487787899999999998
Q gi|254780810|r  168 IAPIGKGQRSLIVAPPRTGKTILLQNIAHSI  198 (423)
Q Consensus       168 ~~pig~gqr~~i~~~~~~gkt~ll~~ia~~~  198 (423)
T Consensus        42 sf~i~~GeivgilG~NGaGKSTLl~~i~Gl~   72 (224)
T cd03220          42 SFEVPRGERIGLIGRNGAGKSTLLRLLAGIY   72 (224)
T ss_pred             EEEECCCCEEEEECCCCCHHHHHHHHHHCCC
T ss_conf             7898389899999799981999999997587