HHsearch alignment for GI: 254780810 and conserved domain: cd03288

>cd03288 ABCC_SUR2 The SUR domain 2. The sulfonylurea receptor SUR is an ATP binding cassette (ABC) protein of the ABCC/MRP family. Unlike other ABC proteins, it has no intrinsic transport function, neither active nor passive, but associates with the potassium channel proteins Kir6.1 or Kir6.2 to form the ATP-sensitive potassium (K(ATP)) channel. Within the channel complex, SUR serves as a regulatory subunit that fine-tunes the gating of Kir6.x in response to alterations in cellular metabolism. It constitutes a major pharmaceutical target as it binds numerous drugs, K(ATP) channel openers and blockers, capable of up- or down-regulating channel activity.
Probab=94.54  E-value=0.027  Score=34.24  Aligned_cols=56  Identities=20%  Similarity=0.253  Sum_probs=40.7

Q ss_pred             HHCCCCHHHCCCCCCCC-CCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             51244300020001122-34324778653213688899886551023122204877878999999999986
Q gi|254780810|r  130 VRNKIHFDNLTPLYPDK-RFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPPRTGKTILLQNIAHSIK  199 (423)
Q Consensus       130 ~~~~~~f~~l~p~~p~~-~i~le~~~~~p~~~~~~~id~~~pig~gqr~~i~~~~~~gkt~ll~~ia~~~~  199 (423)
T Consensus        16 ~~G~I~~~nvsf~Y~~~~~~vL~~--------------inl~I~~Ge~vaIvG~sGsGKSTL~~ll~gl~~   72 (257)
T cd03288          16 LGGEIKIHDLCVRYENNLKPVLKH--------------VKAYIKPGQKVGICGRTGSGKSSLSLAFFRMVD   72 (257)
T ss_pred             CCCEEEEEEEEEEECCCCCCCEEC--------------EEEEECCCCEEEEECCCCCCHHHHHHHHHHCCC
T ss_conf             753799998999939899573105--------------389987999999999999819999999960566