HHsearch alignment for GI: 254780810 and conserved domain: cd03291

>cd03291 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic fibrosis transmembrane regulator (CFTR), the product of the gene mutated in patients with cystic fibrosis, has adapted the ABC transporter structural motif to form a tightly regulated anion channel at the apical surface of many epithelia. Use of the term assembly of a functional ion channel implies the coming together of subunits, or at least smaller not-yet functional components of the active whole. In fact, on the basis of current knowledge only the CFTR polypeptide itself is required to form an ATP- and protein kinase A-dependent low-conductance chloride channel of the type present in the apical membrane of many epithelial cells. CFTR displays the typical organization (IM-ABC)2 and carries a characteristic hydrophilic R-domain that separates IM1-ABC1 from IM2-ABC2.
Probab=95.28  E-value=0.012  Score=36.43  Aligned_cols=203  Identities=17%  Similarity=0.163  Sum_probs=91.3

Q ss_pred             HHHHHCCCCEEEECCCCCCHHHHHHHHHHHHHHCCCCCEEEEEECCCCHHHHHHHHHHHCCEE-EECCCCCCHHHHHHHH
Q ss_conf             865510231222048778789999999999861188646999950878789999998403427-8236678888999999
Q gi|254780810|r  168 IAPIGKGQRSLIVAPPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEV-ISSTFDESAARHVQVA  246 (423)
Q Consensus       168 ~~pig~gqr~~i~~~~~~gkt~ll~~ia~~~~~~~~~v~~i~~ligEr~~ev~e~~~~~~~~v-v~st~d~~~~~~~~~a  246 (423)
T Consensus        57 sf~I~~Ge~vaIVG~sGSGKSTLl~lL~gl~~p~~G~I-~~~g~i~~v~Q~~~lf~~TireNI~~g~~~~~~---~~~~~  132 (282)
T cd03291          57 NLKIEKGEMLAITGSTGSGKTSLLMLILGELEPSEGKI-KHSGRISFSSQFSWIMPGTIKENIIFGVSYDEY---RYKSV  132 (282)
T ss_pred             EEEECCCCEEEEECCCCCHHHHHHHHHHCCCCCCCCEE-EECCEEEEECCCCCCCCCCHHHHHHCCCCCCHH---HHHHH
T ss_conf             89984999999999999819999999957872786589-999999986574422671099997516886889---99999


Q ss_pred             HHHHHHHHHHHHCCCCEEEEEECHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHCHHHHHCCCCCCCCCCCEEE--EEEEE
Q ss_conf             9999999999977992899981638987762001366777677752024665046875225777777850012--11201
Q gi|254780810|r  247 EMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRFFGAARNIKEGGSLTII--GTALV  324 (423)
Q Consensus       247 ~~a~~~a~~~~e~G~dVll~~DslTR~ArA~~~~~~~~g~~~~gg~~~~~l~~~~~~~~~ar~~~~~Gs~T~~--~t~lv  324 (423)
T Consensus       133 ~~~~~--------------l~~~i~~lp~g~~t~vge~G~~LSGGQkQR--------laiARALl~~p~IliLDEpTS~L  190 (282)
T cd03291         133 VKACQ--------------LEEDITKFPEKDNTVLGEGGITLSGGQRAR--------ISLARAVYKDADLYLLDSPFGYL  190 (282)
T ss_pred             HHHHC--------------CHHHHHHCCCCCCCEECCCCCCCCHHHHHH--------HHHHHHHHCCCCEEEEECCCCCC
T ss_conf             99851--------------499998463425523003677589999999--------99999984289989986877668


Q ss_pred             CCCCCCCCHHHHHHH-HC--CCCEEEEEHHHHHCCCCCCCCCCCCCCCCHHHCCCHHHHHHHHHHHHHHHCCCCHHHH
Q ss_conf             267655413889885-22--6607898087884799974053354221015519999999999999996126937899
Q gi|254780810|r  325 DTGSRMDEVIFEEFK-GT--GNSEIVLERKIADKRIFPAMDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAI  399 (423)
Q Consensus       325 etg~~~d~~i~~~~~-~~--~d~~i~L~r~la~~~~~PAId~~~S~sR~~~~l~~~~~~~~~~~~r~~l~~~~~~e~~  399 (423)
T Consensus       191 D~~--tE~~I~~~~l~~~~~~kTvI~ItHrL~~i~~aDrIiVL~~G~Ive~-Gth~ELm~~~g~ya~~~~~~~~~~~~  265 (282)
T cd03291         191 DVF--TEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFY-GTFSELQSLRPDFSSKLMGYDTFDQF  265 (282)
T ss_pred             CHH--HHHHHHHHHHHHHHCCCEEEEEECCHHHHHHCCEEEEEECCEEEEE-CCHHHHHHCCCHHHHHHHCCCCCCHH
T ss_conf             987--8999999999998689989999378888986999999989889997-48899863497899998537640011