HHsearch alignment for GI: 254780810 and conserved domain: cd03295

>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment. ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition, to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=95.67  E-value=0.0072  Score=37.99  Aligned_cols=31  Identities=29%  Similarity=0.448  Sum_probs=27.1

Q ss_pred             HHHHHCCCCEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             8655102312220487787899999999998
Q gi|254780810|r  168 IAPIGKGQRSLIVAPPRTGKTILLQNIAHSI  198 (423)
Q Consensus       168 ~~pig~gqr~~i~~~~~~gkt~ll~~ia~~~  198 (423)
T Consensus        21 sl~i~~Ge~~~ilGpSG~GKSTllr~i~gl~   51 (242)
T cd03295          21 NLEIAKGEFLVLIGPSGSGKTTTMKMINRLI   51 (242)
T ss_pred             EEEECCCCEEEEECCCCCHHHHHHHHHHCCC
T ss_conf             7688699899999999956999999997599