HHsearch alignment for GI: 254780810 and conserved domain: cd03299

>cd03299 ABC_ModC_like Archeal protein closely related to ModC. ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=95.39  E-value=0.01  Score=36.95  Aligned_cols=31  Identities=29%  Similarity=0.531  Sum_probs=27.1

Q ss_pred             HHHHHHCCCCEEEECCCCCCHHHHHHHHHHH
Q ss_conf             8865510231222048778789999999999
Q gi|254780810|r  167 LIAPIGKGQRSLIVAPPRTGKTILLQNIAHS  197 (423)
Q Consensus       167 ~~~pig~gqr~~i~~~~~~gkt~ll~~ia~~  197 (423)
T Consensus        18 vs~~v~~Ge~~~iiGpSGsGKSTLlr~i~Gl   48 (235)
T cd03299          18 VSLEVERGDYFVILGPTGSGKSVLLETIAGF   48 (235)
T ss_pred             CEEEECCCCEEEEECCCCCHHHHHHHHHHCC
T ss_conf             4879889989999999963599999999749