HHsearch alignment for GI: 254780810 and conserved domain: pfam07693

>pfam07693 KAP_NTPase KAP family P-loop domain. The KAP (after Kidins220/ARMS and PifA) family of predicted NTPases are sporadically distributed across a wide phylogenetic range in bacteria and in animals. Many of the prokaryotic KAP NTPases are encoded in plasmids and tend to undergo disruption to form pseudogenes. A unique feature of all eukaryotic and certain bacterial KAP NTPases is the presence of two or four transmembrane helices inserted into the P-loop NTPase domain. These transmembrane helices anchor KAP NTPases in the membrane such that the P-loop domain is located on the intracellular side.
Probab=96.07  E-value=0.055  Score=32.19  Aligned_cols=112  Identities=19%  Similarity=0.224  Sum_probs=61.7

Q ss_pred             HHHHHHHHH--HCCCCEEEECCCCCCHHHHHHHHHHHHHHCCCCCEEEEE---ECCCCHHHHHHHHHHHC----------
Q ss_conf             889988655--102312220487787899999999998611886469999---50878789999998403----------
Q gi|254780810|r  163 RVIDLIAPI--GKGQRSLIVAPPRTGKTILLQNIAHSIKKNHPECYLIVL---LIDERPEEVTDMQRSVQ----------  227 (423)
Q Consensus       163 ~~id~~~pi--g~gqr~~i~~~~~~gkt~ll~~ia~~~~~~~~~v~~i~~---ligEr~~ev~e~~~~~~----------  227 (423)
T Consensus         7 ~la~~i~~~~~~~~~vIgl~G~WGsGKTs~l~~~~~~L~~~~~~~~~v~fn~W~~~~~d~~~~~l~~~l~~~l~~~~~~~   86 (301)
T pfam07693         7 NLAKLLVEPSLAPGFVIGLYGAWGSGKTSFLNLLEDELKEFPEEFHIVYFDPWLFSGQDDAVASLLAALADALEEEYSAL   86 (301)
T ss_pred             HHHHHHHCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCHHHHHHHHHHHHHHHHCCCC
T ss_conf             99999957778999799998989999999999999998613688269998123047967899999999999998750621


Q ss_pred             -------------------------C-------EEEE----CCCCCC----HHHHHHHHHHHHHHHHHHHHCCCCEEEEE
Q ss_conf             -------------------------4-------2782----366788----88999999999999999997799289998
Q gi|254780810|r  228 -------------------------G-------EVIS----STFDES----AARHVQVAEMVIAKAKCLVEYGLDVVILL  267 (423)
Q Consensus       228 -------------------------~-------~vv~----st~d~~----~~~~~~~a~~a~~~a~~~~e~G~dVll~~  267 (423)
T Consensus        87 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~L~~~~~~iVviI  166 (301)
T pfam07693        87 ATKLLIGKKLLALVIGAKIGGNFGVGTALALTGLVASVEGKSLKLLSIEPLKKLQTEIEELRTDIASTLDDLQKRIVVII  166 (301)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEE
T ss_conf             35678766567777667777664455677774100345655410022354420378999999999999973599789997


Q ss_pred             ECHHHHH
Q ss_conf             1638987
Q gi|254780810|r  268 DSITRLC  274 (423)
Q Consensus       268 DslTR~A  274 (423)
T Consensus       167 DDLDRc~  173 (301)
T pfam07693       167 DDLDRCE  173 (301)
T ss_pred             CCCCCCC
T ss_conf             3655488