HHsearch alignment for GI: 254780810 and conserved domain: smart00357

>smart00357 CSP Cold shock protein domain. RNA-binding domain that functions as a RNA-chaperone in bacteria and is involved in regulating translation in eukaryotes. Contains sub-family of RNA-binding domains in the Rho transcription termination factor.
Probab=96.53  E-value=0.0063  Score=38.40  Aligned_cols=55  Identities=45%  Similarity=0.789  Sum_probs=41.6

Q ss_pred             EEEEEECCCCEEEEECCCCCCCCCCCCEEECCCCCC--CCCCCCCEEEEEEEECCCCCCCCC
Q ss_conf             998540477026750454866665560460100001--221259879998862468887630
Q gi|254780810|r   56 GVIEVLQDGFGFLRSPDANYLAGPDDIYVSPSQIKS--FSLKTGDTVEGSIRAPREGERYFA  115 (423)
Q Consensus        56 GvLEIl~dGyGFLR~~~~~yl~~~~DiyVs~slir~--f~Lr~GD~V~g~~r~~~~~~~~~~  115 (423)
T Consensus         2 G~Vk~f~kGfGFI~~~~-----g~~DvFvH~s~i~~~~~~l~~Gd~V~f~v~~~~~~~~~~A   58 (64)
T smart00357        2 GVVKWFNKGFGFIRPDD-----GGKDVFVHPSQIQGGLKSLREGDEVEFKVVSPRGGGKPEA   58 (64)
T ss_pred             CEEEEEECCEEEEEECC-----CCCCEEEEHHHHCCCCCCCCCCCEEEEEEEECCCCCCCEE
T ss_conf             47969828448886189-----9940999869954677744758789999998899998441