BLAST/PSIBLAST alignment of GI: 254780810 and GI: 86359702 at iteration 1
>gi|86359702|ref|YP_471594.1| transcription termination factor Rho [Rhizobium etli CFN 42] Length = 421
>gi|209551503|ref|YP_002283420.1| transcription termination factor Rho [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 421
>gi|86283804|gb|ABC92867.1| transcription termination factor protein [Rhizobium etli CFN 42] Length = 421
>gi|209537259|gb|ACI57194.1| transcription termination factor Rho [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 421
 Score =  727 bits (1877), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/420 (82%), Positives = 389/420 (92%)

Query: 1   MSEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEV 60
           M+EMKLQELK+KSPT LLAFAESLE+ENA+ MRKQELMF+ILK+L+ +DVEIIGEGV+EV
Sbjct: 1   MAEMKLQELKSKSPTDLLAFAESLEVENASTMRKQELMFAILKMLASQDVEIIGEGVVEV 60

Query: 61  LQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVN 120
           LQDGFGFLRS +ANYL GPDDIY+SPSQI+ FSLKTGDTVEG IR P+EGERYFALLKVN
Sbjct: 61  LQDGFGFLRSANANYLPGPDDIYISPSQIRRFSLKTGDTVEGPIRGPKEGERYFALLKVN 120

Query: 121 AINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIV 180
            INFD PE++R+K+HFDNLTPLYP++RF MEL  P +KD+S RVIDL+AP+GKGQR LIV
Sbjct: 121 TINFDDPEKIRHKVHFDNLTPLYPNERFKMELEIPTSKDLSPRVIDLVAPLGKGQRGLIV 180

Query: 181 APPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAA 240
           APPRTGKT+LLQNIAHSI  NHPECYLIVLLIDERPEEVTDMQRSV+GEVISSTFDE A 
Sbjct: 181 APPRTGKTVLLQNIAHSITANHPECYLIVLLIDERPEEVTDMQRSVRGEVISSTFDEPAV 240

Query: 241 RHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRP 300
           RHVQVAEMVI KAK LVE+G DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRP
Sbjct: 241 RHVQVAEMVIEKAKRLVEHGRDVVILLDSITRLGRAYNTVVPSSGKVLTGGVDANALQRP 300

Query: 301 KRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPA 360
           KRFFGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RK+ADKRIFPA
Sbjct: 301 KRFFGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKVADKRIFPA 360

Query: 361 MDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           MDI+KSGTRKEDLLV RQDLQK+F+LRRI++ M ++DAIEFLIDKLKQTK+N DFF SMN
Sbjct: 361 MDILKSGTRKEDLLVPRQDLQKIFVLRRILAPMGTTDAIEFLIDKLKQTKNNSDFFDSMN 420