BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780810|ref|YP_003065223.1| transcription termination
factor Rho [Candidatus Liberibacter asiaticus str. psy62]
         (423 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780810|ref|YP_003065223.1| transcription termination factor Rho [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040487|gb|ACT57283.1| transcription termination factor Rho [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 423

 Score =  860 bits (2221), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 423/423 (100%), Positives = 423/423 (100%)

Query: 1   MSEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEV 60
           MSEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEV
Sbjct: 1   MSEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEV 60

Query: 61  LQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVN 120
           LQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVN
Sbjct: 61  LQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVN 120

Query: 121 AINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIV 180
           AINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIV
Sbjct: 121 AINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIV 180

Query: 181 APPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAA 240
           APPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAA
Sbjct: 181 APPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAA 240

Query: 241 RHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRP 300
           RHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRP
Sbjct: 241 RHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRP 300

Query: 301 KRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPA 360
           KRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPA
Sbjct: 301 KRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPA 360

Query: 361 MDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           MDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN
Sbjct: 361 MDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420

Query: 421 KQN 423
           KQN
Sbjct: 421 KQN 423


>gi|315122033|ref|YP_004062522.1| transcription termination factor Rho [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495435|gb|ADR52034.1| transcription termination factor Rho [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 423

 Score =  833 bits (2152), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/423 (96%), Positives = 418/423 (98%)

Query: 1   MSEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEV 60
           MSEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGV+EV
Sbjct: 1   MSEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVVEV 60

Query: 61  LQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVN 120
           LQDGFGFLRSPDANYLAGPDDIYVSPSQI+SFSLKTGDTVEG IRAP+EGERYFALLKVN
Sbjct: 61  LQDGFGFLRSPDANYLAGPDDIYVSPSQIRSFSLKTGDTVEGPIRAPKEGERYFALLKVN 120

Query: 121 AINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIV 180
           +INFDVPERVRNKIHFDNLTPLYPD+RFNMELN+ E KDISSRVIDLIAPIGKGQRSLIV
Sbjct: 121 SINFDVPERVRNKIHFDNLTPLYPDQRFNMELNDLEKKDISSRVIDLIAPIGKGQRSLIV 180

Query: 181 APPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAA 240
           APPRTGKT+LLQ+IAHSIK NHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAA
Sbjct: 181 APPRTGKTMLLQSIAHSIKNNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAA 240

Query: 241 RHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRP 300
           RHVQVAEMVI+KAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRP
Sbjct: 241 RHVQVAEMVISKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRP 300

Query: 301 KRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPA 360
           KRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPA
Sbjct: 301 KRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPA 360

Query: 361 MDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           MDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNK+FFY MN
Sbjct: 361 MDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKEFFYLMN 420

Query: 421 KQN 423
           KQN
Sbjct: 421 KQN 423


>gi|241206941|ref|YP_002978037.1| transcription termination factor Rho [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240860831|gb|ACS58498.1| transcription termination factor Rho [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 421

 Score =  731 bits (1886), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/420 (82%), Positives = 390/420 (92%)

Query: 1   MSEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEV 60
           M+EMKLQELK+KSPT LLAFAESLE+ENA+ MRKQELMF+ILK+L+ +DVEIIGEGV+EV
Sbjct: 1   MAEMKLQELKSKSPTDLLAFAESLEVENASTMRKQELMFAILKMLASQDVEIIGEGVVEV 60

Query: 61  LQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVN 120
           LQDGFGFLRSP+ANYL GPDDIY+SPSQI+ FSLKTGDTVEG IR P+EGERYFALLKVN
Sbjct: 61  LQDGFGFLRSPNANYLPGPDDIYISPSQIRRFSLKTGDTVEGPIRGPKEGERYFALLKVN 120

Query: 121 AINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIV 180
            INFD PE++R+K+HFDNLTPLYP++RF MEL+ P  KD+S RVIDL+AP+GKGQR LIV
Sbjct: 121 TINFDDPEQIRHKVHFDNLTPLYPNERFKMELDIPTTKDLSPRVIDLVAPLGKGQRGLIV 180

Query: 181 APPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAA 240
           APPRTGKT+LLQNIAHSI  NHPECYLIVLLIDERPEEVTDMQRSV+GEVISSTFDE A 
Sbjct: 181 APPRTGKTVLLQNIAHSITANHPECYLIVLLIDERPEEVTDMQRSVRGEVISSTFDEPAV 240

Query: 241 RHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRP 300
           RHVQVAEMVI KAK LVE+G DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRP
Sbjct: 241 RHVQVAEMVIEKAKRLVEHGRDVVILLDSITRLGRAYNTVVPSSGKVLTGGVDANALQRP 300

Query: 301 KRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPA 360
           KRFFGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RK+ADKRIFPA
Sbjct: 301 KRFFGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKVADKRIFPA 360

Query: 361 MDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           MDI+KSGTRKEDLLV RQDLQK+F+LRRI++ M ++DA+EFLIDKLKQTK+N DFF SMN
Sbjct: 361 MDILKSGTRKEDLLVPRQDLQKIFVLRRILAPMGTTDAVEFLIDKLKQTKNNSDFFESMN 420


>gi|222087930|ref|YP_002546468.1| transcription termination factor Rho [Agrobacterium radiobacter
           K84]
 gi|221725378|gb|ACM28534.1| transcription termination factor Rho [Agrobacterium radiobacter
           K84]
          Length = 421

 Score =  730 bits (1885), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/420 (83%), Positives = 391/420 (93%)

Query: 1   MSEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEV 60
           M+EMKLQELKNKSPT+LLAFAESLE+ENA+ MRKQELMF+ILK L+ +DVEIIGEGV+EV
Sbjct: 1   MAEMKLQELKNKSPTELLAFAESLEVENASTMRKQELMFAILKELASQDVEIIGEGVVEV 60

Query: 61  LQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVN 120
           LQDGFGFLRS +ANYL GPDDIY+SPSQI+ FSLKTGDTVEG IR P+EGERYFALLKVN
Sbjct: 61  LQDGFGFLRSANANYLPGPDDIYISPSQIRRFSLKTGDTVEGPIRGPKEGERYFALLKVN 120

Query: 121 AINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIV 180
            INFD PE++R+K+HFDNLTPLYP++RF MEL+ P NKD+SSRVIDL+AP+GKGQR LIV
Sbjct: 121 TINFDDPEKIRHKVHFDNLTPLYPNERFRMELDVPTNKDLSSRVIDLVAPLGKGQRGLIV 180

Query: 181 APPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAA 240
           APPRTGKT+LLQNIAHSI  NHP+CYLIVLLIDERPEEVTDMQRSV+GEV+SSTFDE A 
Sbjct: 181 APPRTGKTVLLQNIAHSITANHPDCYLIVLLIDERPEEVTDMQRSVRGEVVSSTFDEPAV 240

Query: 241 RHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRP 300
           RHVQVAEMVI KAK LVE+G DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRP
Sbjct: 241 RHVQVAEMVIEKAKRLVEHGRDVVILLDSITRLGRAYNTVVPSSGKVLTGGVDANALQRP 300

Query: 301 KRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPA 360
           KRFFGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RK+ADKRIFPA
Sbjct: 301 KRFFGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKVADKRIFPA 360

Query: 361 MDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           MDI+KSGTRKEDLLV RQDLQK+F+LRRI++ M ++DAIEFLIDKLKQTK+N DFF SMN
Sbjct: 361 MDILKSGTRKEDLLVPRQDLQKIFVLRRILAPMGTTDAIEFLIDKLKQTKNNPDFFDSMN 420


>gi|116254464|ref|YP_770302.1| transcription termination factor Rho [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|115259112|emb|CAK10223.1| putative transcription termination factor rho [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 421

 Score =  728 bits (1878), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/420 (82%), Positives = 389/420 (92%)

Query: 1   MSEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEV 60
           M+EMKLQELK+KSPT LLAFAESLE+ENA+ MRKQELMF+ILK+L+ +DVEIIGEGV+EV
Sbjct: 1   MAEMKLQELKSKSPTDLLAFAESLEVENASTMRKQELMFAILKMLASQDVEIIGEGVVEV 60

Query: 61  LQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVN 120
           LQDGFGFLRS +ANYL GPDDIY+SPSQI+ FSLKTGDTVEG IR P+EGERYFALLKVN
Sbjct: 61  LQDGFGFLRSANANYLPGPDDIYISPSQIRRFSLKTGDTVEGPIRGPKEGERYFALLKVN 120

Query: 121 AINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIV 180
            INFD PE++R+K+HFDNLTPLYP++RF MEL+ P  KD+S RVIDL+AP+GKGQR LIV
Sbjct: 121 TINFDDPEKIRHKVHFDNLTPLYPNERFKMELDIPTTKDLSPRVIDLVAPLGKGQRGLIV 180

Query: 181 APPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAA 240
           APPRTGKT+LLQNIAHSI  NHPECYLIVLLIDERPEEVTDMQRSV+GEVISSTFDE A 
Sbjct: 181 APPRTGKTVLLQNIAHSITANHPECYLIVLLIDERPEEVTDMQRSVRGEVISSTFDEPAV 240

Query: 241 RHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRP 300
           RHVQVAEMVI KAK LVE+G DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRP
Sbjct: 241 RHVQVAEMVIEKAKRLVEHGRDVVILLDSITRLGRAYNTVVPSSGKVLTGGVDANALQRP 300

Query: 301 KRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPA 360
           KRFFGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RK+ADKRIFPA
Sbjct: 301 KRFFGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKVADKRIFPA 360

Query: 361 MDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           MDI+KSGTRKEDLLV RQDLQK+F+LRRI++ M ++DAIEFLIDKLKQTK+N DFF SMN
Sbjct: 361 MDILKSGTRKEDLLVPRQDLQKIFVLRRILAPMGTTDAIEFLIDKLKQTKNNSDFFDSMN 420


>gi|190893980|ref|YP_001980522.1| transcription termination factor protein [Rhizobium etli CIAT 652]
 gi|190699259|gb|ACE93344.1| transcription termination factor protein [Rhizobium etli CIAT 652]
          Length = 421

 Score =  728 bits (1878), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/420 (82%), Positives = 390/420 (92%)

Query: 1   MSEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEV 60
           M+EMKLQELK+KSPT LLAFAESLE+ENA+ MRKQELMF+ILK+L+ +DVEIIGEGV+EV
Sbjct: 1   MAEMKLQELKSKSPTDLLAFAESLEVENASTMRKQELMFAILKMLASQDVEIIGEGVVEV 60

Query: 61  LQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVN 120
           LQDGFGFLRS +ANYL GPDDIY+SPSQI+ FSLKTGDTVEG IR P+EGERYFALLKVN
Sbjct: 61  LQDGFGFLRSANANYLPGPDDIYISPSQIRRFSLKTGDTVEGPIRGPKEGERYFALLKVN 120

Query: 121 AINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIV 180
            INFD PE++R+K+HFDNLTPLYP++RF MEL+ P +KD+S RVIDL+AP+GKGQR LIV
Sbjct: 121 TINFDDPEKIRHKVHFDNLTPLYPNERFKMELDIPTSKDLSPRVIDLVAPLGKGQRGLIV 180

Query: 181 APPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAA 240
           APPRTGKT+LLQNIAHSI  NHPECYLIVLLIDERPEEVTDMQRSV+GEVISSTFDE A 
Sbjct: 181 APPRTGKTVLLQNIAHSITANHPECYLIVLLIDERPEEVTDMQRSVRGEVISSTFDEPAV 240

Query: 241 RHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRP 300
           RHVQVAEMVI KAK LVE+G DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRP
Sbjct: 241 RHVQVAEMVIEKAKRLVEHGRDVVILLDSITRLGRAYNTVVPSSGKVLTGGVDANALQRP 300

Query: 301 KRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPA 360
           KRFFGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RK+ADKRIFPA
Sbjct: 301 KRFFGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKVADKRIFPA 360

Query: 361 MDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           MDI+KSGTRKEDLLV RQDLQK+F+LRRI++ M ++DAIEFLIDKLKQTK+N DFF SMN
Sbjct: 361 MDILKSGTRKEDLLVPRQDLQKIFVLRRILAPMGTTDAIEFLIDKLKQTKNNSDFFDSMN 420


>gi|86359702|ref|YP_471594.1| transcription termination factor Rho [Rhizobium etli CFN 42]
 gi|209551503|ref|YP_002283420.1| transcription termination factor Rho [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|86283804|gb|ABC92867.1| transcription termination factor protein [Rhizobium etli CFN 42]
 gi|209537259|gb|ACI57194.1| transcription termination factor Rho [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 421

 Score =  727 bits (1877), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/420 (82%), Positives = 389/420 (92%)

Query: 1   MSEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEV 60
           M+EMKLQELK+KSPT LLAFAESLE+ENA+ MRKQELMF+ILK+L+ +DVEIIGEGV+EV
Sbjct: 1   MAEMKLQELKSKSPTDLLAFAESLEVENASTMRKQELMFAILKMLASQDVEIIGEGVVEV 60

Query: 61  LQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVN 120
           LQDGFGFLRS +ANYL GPDDIY+SPSQI+ FSLKTGDTVEG IR P+EGERYFALLKVN
Sbjct: 61  LQDGFGFLRSANANYLPGPDDIYISPSQIRRFSLKTGDTVEGPIRGPKEGERYFALLKVN 120

Query: 121 AINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIV 180
            INFD PE++R+K+HFDNLTPLYP++RF MEL  P +KD+S RVIDL+AP+GKGQR LIV
Sbjct: 121 TINFDDPEKIRHKVHFDNLTPLYPNERFKMELEIPTSKDLSPRVIDLVAPLGKGQRGLIV 180

Query: 181 APPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAA 240
           APPRTGKT+LLQNIAHSI  NHPECYLIVLLIDERPEEVTDMQRSV+GEVISSTFDE A 
Sbjct: 181 APPRTGKTVLLQNIAHSITANHPECYLIVLLIDERPEEVTDMQRSVRGEVISSTFDEPAV 240

Query: 241 RHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRP 300
           RHVQVAEMVI KAK LVE+G DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRP
Sbjct: 241 RHVQVAEMVIEKAKRLVEHGRDVVILLDSITRLGRAYNTVVPSSGKVLTGGVDANALQRP 300

Query: 301 KRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPA 360
           KRFFGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RK+ADKRIFPA
Sbjct: 301 KRFFGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKVADKRIFPA 360

Query: 361 MDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           MDI+KSGTRKEDLLV RQDLQK+F+LRRI++ M ++DAIEFLIDKLKQTK+N DFF SMN
Sbjct: 361 MDILKSGTRKEDLLVPRQDLQKIFVLRRILAPMGTTDAIEFLIDKLKQTKNNSDFFDSMN 420


>gi|327191198|gb|EGE58241.1| transcription termination factor protein [Rhizobium etli CNPAF512]
          Length = 421

 Score =  726 bits (1875), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/420 (82%), Positives = 390/420 (92%)

Query: 1   MSEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEV 60
           M+EMKLQELK+KSPT LLAFAESLE+ENA+ MRKQELMF+ILK+L+ +DVEIIGEGV+EV
Sbjct: 1   MAEMKLQELKSKSPTDLLAFAESLEVENASTMRKQELMFAILKMLASQDVEIIGEGVVEV 60

Query: 61  LQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVN 120
           LQDGFGFLRS +ANYL GPDDIY+SPSQI+ FSLKTGDTVEG IR P+EGERYFALLKVN
Sbjct: 61  LQDGFGFLRSANANYLPGPDDIYISPSQIRRFSLKTGDTVEGPIRGPKEGERYFALLKVN 120

Query: 121 AINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIV 180
            INFD PE++R+K+HFDNLTPLYP++RF MEL+ P +KD+S RVIDL+AP+GKGQR LIV
Sbjct: 121 TINFDDPEKIRHKVHFDNLTPLYPNERFKMELDIPTSKDLSPRVIDLVAPLGKGQRGLIV 180

Query: 181 APPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAA 240
           APPRTGKT+LLQNIAHSI  NHPECYLIVLLIDERPEEVTDMQRSV+GEVISSTFDE A 
Sbjct: 181 APPRTGKTVLLQNIAHSITANHPECYLIVLLIDERPEEVTDMQRSVRGEVISSTFDEPAV 240

Query: 241 RHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRP 300
           RHVQVAEMVI KAK LVE+G DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRP
Sbjct: 241 RHVQVAEMVIEKAKRLVEHGRDVVILLDSITRLGRAYNTVVPSSGKVLTGGVDANALQRP 300

Query: 301 KRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPA 360
           KRFFGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RK+ADKRIFPA
Sbjct: 301 KRFFGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKVADKRIFPA 360

Query: 361 MDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           MDI+KSGTRKEDLLV RQDLQK+F+LRRI++ M ++DAIEFLIDKL+QTK+N DFF SMN
Sbjct: 361 MDILKSGTRKEDLLVPRQDLQKIFVLRRILAPMGTTDAIEFLIDKLRQTKNNSDFFDSMN 420


>gi|15890078|ref|NP_355759.1| transcription termination factor Rho [Agrobacterium tumefaciens
           str. C58]
 gi|15158063|gb|AAK88544.1| transcription termination factor Rho [Agrobacterium tumefaciens
           str. C58]
          Length = 421

 Score =  726 bits (1873), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/420 (82%), Positives = 387/420 (92%)

Query: 1   MSEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEV 60
           M+EMKLQELK+KSPT LL FAESLE+ENA+ MRKQELMF+ILK+L+ +DVEIIGEGV+EV
Sbjct: 1   MAEMKLQELKSKSPTDLLTFAESLEVENASTMRKQELMFAILKILASQDVEIIGEGVVEV 60

Query: 61  LQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVN 120
           LQDGFGFLRS +ANYL GPDDIY+SPSQI+ FSLKTGDTVEG IR P+EGERYFALLKVN
Sbjct: 61  LQDGFGFLRSANANYLPGPDDIYISPSQIRRFSLKTGDTVEGPIRGPKEGERYFALLKVN 120

Query: 121 AINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIV 180
            INFD PE++R+K+HFDNLTPLYP++RF MEL  P +KD+SSRVIDL+AP+GKGQR LIV
Sbjct: 121 TINFDDPEKIRHKVHFDNLTPLYPNERFKMELEVPTSKDLSSRVIDLVAPLGKGQRGLIV 180

Query: 181 APPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAA 240
           APPRTGKT+LLQNIAHSI  NHPECYLIVLLIDERPEEVTDMQRSV+GEV+SSTFDE A 
Sbjct: 181 APPRTGKTVLLQNIAHSITANHPECYLIVLLIDERPEEVTDMQRSVKGEVVSSTFDEPAV 240

Query: 241 RHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRP 300
           RHVQVAEMVI KAK LVE+G DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRP
Sbjct: 241 RHVQVAEMVIEKAKRLVEHGRDVVILLDSITRLGRAYNTVVPSSGKVLTGGVDANALQRP 300

Query: 301 KRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPA 360
           KRFFGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RK+ADKRIFPA
Sbjct: 301 KRFFGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKVADKRIFPA 360

Query: 361 MDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           +DI+KSGTRKEDLLV RQDLQK+F+LRRI++ M + DAIEFLIDKLKQTK N DFF SMN
Sbjct: 361 LDILKSGTRKEDLLVPRQDLQKIFVLRRILAPMGTMDAIEFLIDKLKQTKTNSDFFESMN 420


>gi|163757467|ref|ZP_02164556.1| transcription termination factor Rho [Hoeflea phototrophica DFL-43]
 gi|162284969|gb|EDQ35251.1| transcription termination factor Rho [Hoeflea phototrophica DFL-43]
          Length = 421

 Score =  726 bits (1873), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/420 (81%), Positives = 390/420 (92%)

Query: 1   MSEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEV 60
           M EMKLQELKNK+PT LLAFAES+E+ENA+VMRKQELMF+ILK L+ +DVEIIGEGV+EV
Sbjct: 1   MQEMKLQELKNKTPTDLLAFAESVEVENASVMRKQELMFAILKQLAAQDVEIIGEGVVEV 60

Query: 61  LQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVN 120
           LQDGFGF+RS +ANYL GPDDIY+SPSQI+ FSLKTGDTVEG IR P+EGERYFALLKVN
Sbjct: 61  LQDGFGFMRSANANYLPGPDDIYISPSQIRRFSLKTGDTVEGPIRGPKEGERYFALLKVN 120

Query: 121 AINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIV 180
            INF+ PE++R+K+HFDNLTPLYP++RF ME++NP +KDISSRVIDL+AP+GKGQR LIV
Sbjct: 121 TINFEDPEKIRHKVHFDNLTPLYPNERFKMEIDNPTSKDISSRVIDLVAPLGKGQRGLIV 180

Query: 181 APPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAA 240
           APPRTGKT+LLQNIAHSI  NHP+CYLIVLLIDERPEEVTDMQRSV+GEV+SSTFDE A 
Sbjct: 181 APPRTGKTVLLQNIAHSITANHPDCYLIVLLIDERPEEVTDMQRSVKGEVVSSTFDEPAV 240

Query: 241 RHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRP 300
           RHVQVAEMVI KAK LVE+G DV+ILLDSITRL RAYN ++PSSGK+LTGGVDANALQRP
Sbjct: 241 RHVQVAEMVIEKAKRLVEHGRDVIILLDSITRLGRAYNTVVPSSGKVLTGGVDANALQRP 300

Query: 301 KRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPA 360
           KRFFGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RK+ADKRIFP+
Sbjct: 301 KRFFGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKVADKRIFPS 360

Query: 361 MDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           MDI+KSGTRKEDLLV RQDLQK+F+LRRI++ M ++DAIEFLIDKLKQTK N DFF SMN
Sbjct: 361 MDILKSGTRKEDLLVPRQDLQKIFVLRRILAPMGTTDAIEFLIDKLKQTKTNGDFFDSMN 420


>gi|325294203|ref|YP_004280067.1| transcription termination factor Rho [Agrobacterium sp. H13-3]
 gi|325062056|gb|ADY65747.1| transcription termination factor Rho [Agrobacterium sp. H13-3]
          Length = 421

 Score =  725 bits (1872), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/420 (82%), Positives = 387/420 (92%)

Query: 1   MSEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEV 60
           M+EMKLQELK+KSPT LL FAESLE+ENA+ MRKQELMF+ILKVL+ +D+EIIGEGV+EV
Sbjct: 1   MAEMKLQELKSKSPTDLLTFAESLEVENASTMRKQELMFAILKVLASQDIEIIGEGVVEV 60

Query: 61  LQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVN 120
           LQDGFGFLRS +ANYL GPDDIY+SPSQI+ FSLKTGDTVEG IR P+EGERYFALLKVN
Sbjct: 61  LQDGFGFLRSANANYLPGPDDIYISPSQIRRFSLKTGDTVEGPIRGPKEGERYFALLKVN 120

Query: 121 AINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIV 180
            INFD PE++R+K+HFDNLTPLYP++RF MEL  P +KD+SSRVIDL+AP+GKGQR LIV
Sbjct: 121 TINFDDPEKIRHKVHFDNLTPLYPNERFKMELELPTSKDLSSRVIDLVAPLGKGQRGLIV 180

Query: 181 APPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAA 240
           APPRTGKT+LLQNIAHSI  NHPECYLIVLLIDERPEEVTDMQRSV+GEV+SSTFDE A 
Sbjct: 181 APPRTGKTVLLQNIAHSITANHPECYLIVLLIDERPEEVTDMQRSVKGEVVSSTFDEPAV 240

Query: 241 RHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRP 300
           RHVQVAEMVI KAK LVE+G DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRP
Sbjct: 241 RHVQVAEMVIEKAKRLVEHGRDVVILLDSITRLGRAYNTVVPSSGKVLTGGVDANALQRP 300

Query: 301 KRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPA 360
           KRFFGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RK+ADKRIFPA
Sbjct: 301 KRFFGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKVADKRIFPA 360

Query: 361 MDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           +DI+KSGTRKEDLLV RQDLQK+F+LRRI++ M + DAIEFLIDKLKQTK N DFF SMN
Sbjct: 361 LDILKSGTRKEDLLVPRQDLQKIFVLRRILAPMGTMDAIEFLIDKLKQTKTNSDFFESMN 420


>gi|222150247|ref|YP_002551204.1| transcription termination factor Rho [Agrobacterium vitis S4]
 gi|221737229|gb|ACM38192.1| transcription termination factor Rho [Agrobacterium vitis S4]
          Length = 421

 Score =  724 bits (1870), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/420 (82%), Positives = 389/420 (92%)

Query: 1   MSEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEV 60
           M+EMKLQELK+KSPT LLAFAESLE+ENA+ MRKQELMF+ILK+L+ +DVEIIGEGV+EV
Sbjct: 1   MAEMKLQELKSKSPTDLLAFAESLEVENASTMRKQELMFAILKMLASQDVEIIGEGVVEV 60

Query: 61  LQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVN 120
           LQDGFGF+RS +ANYL GPDDIY+SPSQI+ FSLKTGDTVEG IR P+EGERYFALLKVN
Sbjct: 61  LQDGFGFMRSANANYLPGPDDIYISPSQIRRFSLKTGDTVEGPIRGPKEGERYFALLKVN 120

Query: 121 AINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIV 180
            INF+ PE++R+K+HFDNLTPLYP++RF MEL  P +KD+SSRVIDL+AP+GKGQR LIV
Sbjct: 121 TINFEDPEKIRHKVHFDNLTPLYPNERFKMELEIPTSKDLSSRVIDLVAPLGKGQRGLIV 180

Query: 181 APPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAA 240
           APPRTGKT+LLQNIAHSI  NHPECYLIVLLIDERPEEVTDMQRSV+GEV+SSTFDE A 
Sbjct: 181 APPRTGKTVLLQNIAHSITANHPECYLIVLLIDERPEEVTDMQRSVRGEVVSSTFDEPAV 240

Query: 241 RHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRP 300
           RHVQVAEMVI KAK LVE+G DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRP
Sbjct: 241 RHVQVAEMVIEKAKRLVEHGRDVVILLDSITRLGRAYNTVVPSSGKVLTGGVDANALQRP 300

Query: 301 KRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPA 360
           KRFFGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RK+ADKRIFP+
Sbjct: 301 KRFFGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKVADKRIFPS 360

Query: 361 MDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           MDI+KSGTRKEDLLV RQDLQK+F+LRRI++ M ++DAIEFLIDKLKQTK N DFF SMN
Sbjct: 361 MDILKSGTRKEDLLVPRQDLQKIFVLRRILAPMGTTDAIEFLIDKLKQTKTNGDFFESMN 420


>gi|15967092|ref|NP_387445.1| transcription termination factor Rho [Sinorhizobium meliloti 1021]
 gi|307302554|ref|ZP_07582311.1| transcription termination factor Rho [Sinorhizobium meliloti
           BL225C]
 gi|307316115|ref|ZP_07595559.1| transcription termination factor Rho [Sinorhizobium meliloti AK83]
 gi|15076365|emb|CAC47918.1| Probable transcription termination factor Rho protein
           [Sinorhizobium meliloti 1021]
 gi|306897955|gb|EFN28697.1| transcription termination factor Rho [Sinorhizobium meliloti AK83]
 gi|306903224|gb|EFN33814.1| transcription termination factor Rho [Sinorhizobium meliloti
           BL225C]
          Length = 421

 Score =  723 bits (1866), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/420 (81%), Positives = 388/420 (92%)

Query: 1   MSEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEV 60
           M+EMKLQELKNK+PT LLAFAE LE+ENA+ MRKQELMF+ILK+L+ +++EIIGEGV+EV
Sbjct: 1   MAEMKLQELKNKTPTDLLAFAEELEVENASTMRKQELMFAILKMLAQQEIEIIGEGVVEV 60

Query: 61  LQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVN 120
           LQDGFGFLRS +ANYL GPDDIY+SPSQI+ FSLKTGDTVEG IR P+EGERYFALLKVN
Sbjct: 61  LQDGFGFLRSANANYLPGPDDIYISPSQIRRFSLKTGDTVEGPIRGPKEGERYFALLKVN 120

Query: 121 AINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIV 180
            INFD PE++R+K+HFDNLTPLYP++RF MEL  P +KD+S+RVIDL+AP+GKGQR LIV
Sbjct: 121 TINFDDPEKIRHKVHFDNLTPLYPNERFKMELEVPTSKDLSARVIDLVAPLGKGQRGLIV 180

Query: 181 APPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAA 240
           APPRTGKT+LLQNIAHSI  NHPECYLIVLLIDERPEEVTDMQRSV+GEV+SSTFDE A 
Sbjct: 181 APPRTGKTVLLQNIAHSITANHPECYLIVLLIDERPEEVTDMQRSVKGEVVSSTFDEPAT 240

Query: 241 RHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRP 300
           RHVQVAEMVI KAK LVE+G DVVILLDS+TRL RAYN ++PSSGK+LTGGVDANALQRP
Sbjct: 241 RHVQVAEMVIEKAKRLVEHGRDVVILLDSVTRLGRAYNTVVPSSGKVLTGGVDANALQRP 300

Query: 301 KRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPA 360
           KRFFGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RK+ADKRIFPA
Sbjct: 301 KRFFGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKVADKRIFPA 360

Query: 361 MDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           MDI+KSGTRKEDLLV RQDLQK+F+LRRI++ M ++DAIEFLIDKLKQTK N DFF SMN
Sbjct: 361 MDILKSGTRKEDLLVPRQDLQKIFVLRRILAPMGTTDAIEFLIDKLKQTKTNGDFFDSMN 420


>gi|110635802|ref|YP_676010.1| transcription termination factor Rho [Mesorhizobium sp. BNC1]
 gi|110286786|gb|ABG64845.1| transcription termination factor Rho [Chelativorans sp. BNC1]
          Length = 429

 Score =  722 bits (1864), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/420 (81%), Positives = 387/420 (92%)

Query: 1   MSEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEV 60
           M EMKLQELK+KSPT L+AFAESLE+ENA++MRKQELMF+ILK LS +D+EI+G+GV+EV
Sbjct: 9   MQEMKLQELKSKSPTDLIAFAESLEVENASIMRKQELMFAILKKLSMQDIEIVGDGVVEV 68

Query: 61  LQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVN 120
           LQDGFGFLRS  ANYL GPDDIY+SPSQI+ FSLKTGDTVEG IR+P+EGERYFALLKVN
Sbjct: 69  LQDGFGFLRSATANYLPGPDDIYISPSQIRRFSLKTGDTVEGPIRSPKEGERYFALLKVN 128

Query: 121 AINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIV 180
            INF+ PE++R+KIHFDNLTPLYPD+R  ME+ NP  KD+S RVIDL+AP+GKGQR LIV
Sbjct: 129 TINFEDPEKIRHKIHFDNLTPLYPDERLRMEIENPTTKDLSPRVIDLVAPLGKGQRGLIV 188

Query: 181 APPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAA 240
           APPRTGKT+LLQNIAHSI  NHPECYLIVLLIDERPEEVTDMQRSV+GEVISSTFDE AA
Sbjct: 189 APPRTGKTVLLQNIAHSITTNHPECYLIVLLIDERPEEVTDMQRSVKGEVISSTFDEPAA 248

Query: 241 RHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRP 300
           RHVQVAEMVI KAK LVE+G DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRP
Sbjct: 249 RHVQVAEMVIEKAKRLVEHGRDVVILLDSITRLGRAYNTVVPSSGKVLTGGVDANALQRP 308

Query: 301 KRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPA 360
           KRFFGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RK+ADKRI+PA
Sbjct: 309 KRFFGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKVADKRIYPA 368

Query: 361 MDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           MDI+KSGTRKEDLLV RQDLQK+F+LRRI++ M ++DAIEFLIDKLKQTK N +FF SMN
Sbjct: 369 MDILKSGTRKEDLLVPRQDLQKIFVLRRILAPMGTTDAIEFLIDKLKQTKGNAEFFDSMN 428


>gi|153008192|ref|YP_001369407.1| transcription termination factor Rho [Ochrobactrum anthropi ATCC
           49188]
 gi|151560080|gb|ABS13578.1| transcription termination factor Rho [Ochrobactrum anthropi ATCC
           49188]
          Length = 421

 Score =  722 bits (1863), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/420 (81%), Positives = 387/420 (92%)

Query: 1   MSEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEV 60
           M EMKLQELKNK+P +LLAFAE+LE+ENA+ MRKQELMF+ILK L+ +DVEIIGEGV+EV
Sbjct: 1   MQEMKLQELKNKTPVELLAFAETLEVENASAMRKQELMFAILKKLAAQDVEIIGEGVVEV 60

Query: 61  LQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVN 120
           LQDGFGFLRS DANYL GPDDIY+SPSQ++ FSLKTGDTVEG IR P+EGERYFALLKVN
Sbjct: 61  LQDGFGFLRSADANYLPGPDDIYISPSQLRRFSLKTGDTVEGPIRGPKEGERYFALLKVN 120

Query: 121 AINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIV 180
           +INF+ PE++R+K+HFDNLTPLYP++RF MEL  P +KD+S RVIDL+AP+GKGQR LIV
Sbjct: 121 SINFEDPEKIRHKVHFDNLTPLYPNERFKMELEVPTSKDLSPRVIDLVAPLGKGQRGLIV 180

Query: 181 APPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAA 240
           APPRTGKT+LLQNIAHSI  NHPECYLIVLLIDERPEEVTDMQRSV+GEVISSTFDE AA
Sbjct: 181 APPRTGKTVLLQNIAHSITANHPECYLIVLLIDERPEEVTDMQRSVKGEVISSTFDEPAA 240

Query: 241 RHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRP 300
           RHVQVAEMVI KAK LVE+G DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRP
Sbjct: 241 RHVQVAEMVIEKAKRLVEHGRDVVILLDSITRLGRAYNTVVPSSGKVLTGGVDANALQRP 300

Query: 301 KRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPA 360
           KRFFGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RK+ADKRIFPA
Sbjct: 301 KRFFGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKVADKRIFPA 360

Query: 361 MDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           MDI+KSGTRKEDLLV R DLQK+F+LRRI++ M ++DAIEFLIDKLKQTK N +FF SMN
Sbjct: 361 MDILKSGTRKEDLLVPRADLQKIFVLRRILAPMGTTDAIEFLIDKLKQTKSNSEFFDSMN 420


>gi|254718106|ref|ZP_05179917.1| transcription termination factor Rho [Brucella sp. 83/13]
 gi|265983059|ref|ZP_06095794.1| transcription termination factor Rho [Brucella sp. 83/13]
 gi|306839731|ref|ZP_07472533.1| transcription termination factor Rho [Brucella sp. NF 2653]
 gi|264661651|gb|EEZ31912.1| transcription termination factor Rho [Brucella sp. 83/13]
 gi|306405191|gb|EFM61468.1| transcription termination factor Rho [Brucella sp. NF 2653]
          Length = 421

 Score =  721 bits (1862), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/420 (81%), Positives = 386/420 (91%)

Query: 1   MSEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEV 60
           M EMKLQELKNK+P +LLAFAE+LE+ENA+ MRKQELMF+ILK L+ +DVEIIGEGV+EV
Sbjct: 1   MQEMKLQELKNKTPVELLAFAETLEVENASAMRKQELMFAILKKLAAQDVEIIGEGVVEV 60

Query: 61  LQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVN 120
           LQDGFGFLRS DANYL GPDDIY+SPSQ++ FSLKTGDTVEG IR P+EGERYFALLKVN
Sbjct: 61  LQDGFGFLRSADANYLPGPDDIYISPSQLRRFSLKTGDTVEGPIRGPKEGERYFALLKVN 120

Query: 121 AINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIV 180
            INF+ PE++R+K+HFDNLTPLYP++RF MEL  P +KD+S RVIDL+AP+GKGQR LIV
Sbjct: 121 TINFEDPEKIRHKVHFDNLTPLYPNERFKMELEVPTSKDLSPRVIDLVAPLGKGQRGLIV 180

Query: 181 APPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAA 240
           APPRTGKT+LLQNIAHSI  NHPECYLIVLLIDERPEEVTDMQRSV+GEVISSTFDE AA
Sbjct: 181 APPRTGKTVLLQNIAHSITANHPECYLIVLLIDERPEEVTDMQRSVKGEVISSTFDEPAA 240

Query: 241 RHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRP 300
           RHVQVAEMVI KAK LVE+G DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRP
Sbjct: 241 RHVQVAEMVIEKAKRLVEHGRDVVILLDSITRLGRAYNTVVPSSGKVLTGGVDANALQRP 300

Query: 301 KRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPA 360
           KRFFGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RK+ADKRIFPA
Sbjct: 301 KRFFGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKVADKRIFPA 360

Query: 361 MDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           MDI+KSGTRKEDLLV R DLQK+F+LRRI++ M ++DAIEFLIDKLKQTK N +FF SMN
Sbjct: 361 MDILKSGTRKEDLLVPRTDLQKIFVLRRILAPMGTTDAIEFLIDKLKQTKSNAEFFDSMN 420


>gi|17986287|ref|NP_538921.1| transcription termination factor Rho [Brucella melitensis bv. 1
           str. 16M]
 gi|23502912|ref|NP_699039.1| transcription termination factor Rho [Brucella suis 1330]
 gi|62290908|ref|YP_222701.1| transcription termination factor Rho [Brucella abortus bv. 1 str.
           9-941]
 gi|82700819|ref|YP_415393.1| transcription termination factor Rho [Brucella melitensis biovar
           Abortus 2308]
 gi|161619978|ref|YP_001593865.1| transcription termination factor Rho [Brucella canis ATCC 23365]
 gi|189025121|ref|YP_001935889.1| transcription termination factor Rho [Brucella abortus S19]
 gi|225626443|ref|ZP_03784482.1| transcription termination factor Rho [Brucella ceti str. Cudo]
 gi|225853494|ref|YP_002733727.1| transcription termination factor Rho [Brucella melitensis ATCC
           23457]
 gi|237816413|ref|ZP_04595406.1| transcription termination factor Rho [Brucella abortus str. 2308 A]
 gi|254690196|ref|ZP_05153450.1| transcription termination factor Rho [Brucella abortus bv. 6 str.
           870]
 gi|254694686|ref|ZP_05156514.1| transcription termination factor Rho [Brucella abortus bv. 3 str.
           Tulya]
 gi|254696313|ref|ZP_05158141.1| transcription termination factor Rho [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254709041|ref|ZP_05170852.1| transcription termination factor Rho [Brucella pinnipedialis B2/94]
 gi|254713533|ref|ZP_05175344.1| transcription termination factor Rho [Brucella ceti M644/93/1]
 gi|254716112|ref|ZP_05177923.1| transcription termination factor Rho [Brucella ceti M13/05/1]
 gi|254731229|ref|ZP_05189807.1| transcription termination factor Rho [Brucella abortus bv. 4 str.
           292]
 gi|256030566|ref|ZP_05444180.1| transcription termination factor Rho [Brucella pinnipedialis
           M292/94/1]
 gi|256045667|ref|ZP_05448545.1| transcription termination factor Rho [Brucella melitensis bv. 1
           str. Rev.1]
 gi|256060028|ref|ZP_05450210.1| transcription termination factor Rho [Brucella neotomae 5K33]
 gi|256112387|ref|ZP_05453308.1| transcription termination factor Rho [Brucella melitensis bv. 3
           str. Ether]
 gi|256158562|ref|ZP_05456452.1| transcription termination factor Rho [Brucella ceti M490/95/1]
 gi|256258450|ref|ZP_05463986.1| transcription termination factor Rho [Brucella abortus bv. 9 str.
           C68]
 gi|256263024|ref|ZP_05465556.1| transcription termination factor Rho [Brucella melitensis bv. 2
           str. 63/9]
 gi|256370462|ref|YP_003107973.1| transcription termination factor Rho [Brucella microti CCM 4915]
 gi|260169471|ref|ZP_05756282.1| transcription termination factor Rho [Brucella sp. F5/99]
 gi|260546170|ref|ZP_05821910.1| transcription termination factor Rho [Brucella abortus NCTC 8038]
 gi|260562969|ref|ZP_05833455.1| transcription termination factor Rho [Brucella melitensis bv. 1
           str. 16M]
 gi|260567465|ref|ZP_05837935.1| transcription termination factor Rho [Brucella suis bv. 4 str. 40]
 gi|260755737|ref|ZP_05868085.1| transcription termination factor Rho [Brucella abortus bv. 6 str.
           870]
 gi|260758961|ref|ZP_05871309.1| transcription termination factor Rho [Brucella abortus bv. 4 str.
           292]
 gi|260760685|ref|ZP_05873028.1| transcription termination factor Rho [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260884763|ref|ZP_05896377.1| transcription termination factor Rho [Brucella abortus bv. 9 str.
           C68]
 gi|261215014|ref|ZP_05929295.1| transcription termination factor Rho [Brucella abortus bv. 3 str.
           Tulya]
 gi|261217883|ref|ZP_05932164.1| transcription termination factor Rho [Brucella ceti M13/05/1]
 gi|261316540|ref|ZP_05955737.1| transcription termination factor Rho [Brucella pinnipedialis B2/94]
 gi|261321267|ref|ZP_05960464.1| transcription termination factor Rho [Brucella ceti M644/93/1]
 gi|261324005|ref|ZP_05963202.1| transcription termination factor Rho [Brucella neotomae 5K33]
 gi|261758998|ref|ZP_06002707.1| transcription termination factor Rho [Brucella sp. F5/99]
 gi|265987614|ref|ZP_06100171.1| transcription termination factor Rho [Brucella pinnipedialis
           M292/94/1]
 gi|265992089|ref|ZP_06104646.1| transcription termination factor Rho [Brucella melitensis bv. 1
           str. Rev.1]
 gi|265993825|ref|ZP_06106382.1| transcription termination factor Rho [Brucella melitensis bv. 3
           str. Ether]
 gi|265997074|ref|ZP_06109631.1| transcription termination factor Rho [Brucella ceti M490/95/1]
 gi|297247292|ref|ZP_06931010.1| transcription termination factor Rho [Brucella abortus bv. 5 str.
           B3196]
 gi|306843480|ref|ZP_07476081.1| transcription termination factor Rho [Brucella sp. BO1]
 gi|17981869|gb|AAL51185.1| transcription termination factor rho [Brucella melitensis bv. 1
           str. 16M]
 gi|23348944|gb|AAN30954.1| transcription termination factor Rho [Brucella suis 1330]
 gi|62197040|gb|AAX75340.1| Rho, transcription termination factor Rho [Brucella abortus bv. 1
           str. 9-941]
 gi|82616920|emb|CAJ12021.1| H+-transporting two-sector ATPase, alpha/beta subunit, central
           region:ATP/GTP-binding site motif A (P-loop):Cold-shock
           DNA-bi [Brucella melitensis biovar Abortus 2308]
 gi|161336789|gb|ABX63094.1| Transcription termination factor rho [Brucella canis ATCC 23365]
 gi|189020693|gb|ACD73415.1| transcription termination factor Rho [Brucella abortus S19]
 gi|225618100|gb|EEH15143.1| transcription termination factor Rho [Brucella ceti str. Cudo]
 gi|225641859|gb|ACO01773.1| transcription termination factor Rho [Brucella melitensis ATCC
           23457]
 gi|237788480|gb|EEP62695.1| transcription termination factor Rho [Brucella abortus str. 2308 A]
 gi|256000625|gb|ACU49024.1| transcription termination factor Rho [Brucella microti CCM 4915]
 gi|260096277|gb|EEW80153.1| transcription termination factor Rho [Brucella abortus NCTC 8038]
 gi|260152985|gb|EEW88077.1| transcription termination factor Rho [Brucella melitensis bv. 1
           str. 16M]
 gi|260156983|gb|EEW92063.1| transcription termination factor Rho [Brucella suis bv. 4 str. 40]
 gi|260669279|gb|EEX56219.1| transcription termination factor Rho [Brucella abortus bv. 4 str.
           292]
 gi|260671117|gb|EEX57938.1| transcription termination factor Rho [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260675845|gb|EEX62666.1| transcription termination factor Rho [Brucella abortus bv. 6 str.
           870]
 gi|260874291|gb|EEX81360.1| transcription termination factor Rho [Brucella abortus bv. 9 str.
           C68]
 gi|260916621|gb|EEX83482.1| transcription termination factor Rho [Brucella abortus bv. 3 str.
           Tulya]
 gi|260922972|gb|EEX89540.1| transcription termination factor Rho [Brucella ceti M13/05/1]
 gi|261293957|gb|EEX97453.1| transcription termination factor Rho [Brucella ceti M644/93/1]
 gi|261295763|gb|EEX99259.1| transcription termination factor Rho [Brucella pinnipedialis B2/94]
 gi|261299985|gb|EEY03482.1| transcription termination factor Rho [Brucella neotomae 5K33]
 gi|261738982|gb|EEY26978.1| transcription termination factor Rho [Brucella sp. F5/99]
 gi|262551542|gb|EEZ07532.1| transcription termination factor Rho [Brucella ceti M490/95/1]
 gi|262764806|gb|EEZ10727.1| transcription termination factor Rho [Brucella melitensis bv. 3
           str. Ether]
 gi|263003155|gb|EEZ15448.1| transcription termination factor Rho [Brucella melitensis bv. 1
           str. Rev.1]
 gi|263092896|gb|EEZ17071.1| transcription termination factor Rho [Brucella melitensis bv. 2
           str. 63/9]
 gi|264659811|gb|EEZ30072.1| transcription termination factor Rho [Brucella pinnipedialis
           M292/94/1]
 gi|297174461|gb|EFH33808.1| transcription termination factor Rho [Brucella abortus bv. 5 str.
           B3196]
 gi|306276171|gb|EFM57871.1| transcription termination factor Rho [Brucella sp. BO1]
 gi|326410060|gb|ADZ67125.1| transcription termination factor Rho [Brucella melitensis M28]
 gi|326539777|gb|ADZ87992.1| transcription termination factor Rho [Brucella melitensis M5-90]
          Length = 421

 Score =  721 bits (1861), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/420 (81%), Positives = 386/420 (91%)

Query: 1   MSEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEV 60
           M EMKLQELKNK+P +LLAFAE+LE+ENA+ MRKQELMF+ILK L+ +DVEIIGEGV+EV
Sbjct: 1   MQEMKLQELKNKTPVELLAFAETLEVENASAMRKQELMFAILKKLAAQDVEIIGEGVVEV 60

Query: 61  LQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVN 120
           LQDGFGFLRS DANYL GPDDIY+SPSQ++ FSLKTGDTVEG IR P+EGERYFALLKVN
Sbjct: 61  LQDGFGFLRSADANYLPGPDDIYISPSQLRRFSLKTGDTVEGPIRGPKEGERYFALLKVN 120

Query: 121 AINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIV 180
            INF+ PE++R+K+HFDNLTPLYP++RF MEL  P +KD+S RVIDL+AP+GKGQR LIV
Sbjct: 121 TINFEDPEKIRHKVHFDNLTPLYPNERFKMELEVPTSKDLSPRVIDLVAPLGKGQRGLIV 180

Query: 181 APPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAA 240
           APPRTGKT+LLQNIAHSI  NHPECYLIVLLIDERPEEVTDMQRSV+GEVISSTFDE AA
Sbjct: 181 APPRTGKTVLLQNIAHSITANHPECYLIVLLIDERPEEVTDMQRSVKGEVISSTFDEPAA 240

Query: 241 RHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRP 300
           RHVQVAEMVI KAK LVE+G DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRP
Sbjct: 241 RHVQVAEMVIEKAKRLVEHGRDVVILLDSITRLGRAYNTVVPSSGKVLTGGVDANALQRP 300

Query: 301 KRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPA 360
           KRFFGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RK+ADKRIFPA
Sbjct: 301 KRFFGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKVADKRIFPA 360

Query: 361 MDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           MDI+KSGTRKEDLLV R DLQK+F+LRRI++ M ++DAIEFLIDKLKQTK N +FF SMN
Sbjct: 361 MDILKSGTRKEDLLVPRADLQKIFVLRRILAPMGTTDAIEFLIDKLKQTKSNAEFFDSMN 420


>gi|239833105|ref|ZP_04681434.1| transcription termination factor Rho [Ochrobactrum intermedium LMG
           3301]
 gi|239825372|gb|EEQ96940.1| transcription termination factor Rho [Ochrobactrum intermedium LMG
           3301]
          Length = 421

 Score =  721 bits (1861), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/420 (81%), Positives = 387/420 (92%)

Query: 1   MSEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEV 60
           M EMKLQELKNK+P +LLAFAE+LE+ENA+ MRKQELMF+ILK L+ +DVEIIGEGV+EV
Sbjct: 1   MQEMKLQELKNKTPVELLAFAETLEVENASAMRKQELMFAILKKLAAQDVEIIGEGVVEV 60

Query: 61  LQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVN 120
           LQDGFGFLRS DANYL GPDDIY+SPSQ++ FSLKTGDTVEG IR P+EGERYFALLKVN
Sbjct: 61  LQDGFGFLRSADANYLPGPDDIYISPSQLRRFSLKTGDTVEGPIRGPKEGERYFALLKVN 120

Query: 121 AINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIV 180
           +INF+ PE++R+K+HFDNLTPLYP++RF MEL  P +KD+S RVIDL+AP+GKGQR LIV
Sbjct: 121 SINFEDPEKIRHKVHFDNLTPLYPNERFKMELEVPTSKDLSPRVIDLVAPLGKGQRGLIV 180

Query: 181 APPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAA 240
           APPRTGKT+LLQNIAHSI  NHPECYLIVLLIDERPEEVTDMQRSV+GEVISSTFDE AA
Sbjct: 181 APPRTGKTVLLQNIAHSITANHPECYLIVLLIDERPEEVTDMQRSVKGEVISSTFDEPAA 240

Query: 241 RHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRP 300
           RHVQVAEMVI KAK LVE+G DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRP
Sbjct: 241 RHVQVAEMVIEKAKRLVEHGRDVVILLDSITRLGRAYNTVVPSSGKVLTGGVDANALQRP 300

Query: 301 KRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPA 360
           KRFFGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RK+ADKRIFPA
Sbjct: 301 KRFFGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKVADKRIFPA 360

Query: 361 MDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           MDI+KSGTRKEDLLV R DLQK+F+LRRI++ M ++DAIEFLIDKLKQTK N +FF SMN
Sbjct: 361 MDILKSGTRKEDLLVPRADLQKIFVLRRILAPMGTTDAIEFLIDKLKQTKSNGEFFDSMN 420


>gi|150398398|ref|YP_001328865.1| transcription termination factor Rho [Sinorhizobium medicae WSM419]
 gi|150029913|gb|ABR62030.1| transcription termination factor Rho [Sinorhizobium medicae WSM419]
          Length = 421

 Score =  720 bits (1859), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/420 (81%), Positives = 387/420 (92%)

Query: 1   MSEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEV 60
           M+EMKLQELKNK+PT LLA AE LE+ENA+ MRKQELMF+ILK+L+ +++EIIGEGV+EV
Sbjct: 1   MAEMKLQELKNKTPTDLLALAEELEVENASTMRKQELMFAILKMLAQQEIEIIGEGVVEV 60

Query: 61  LQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVN 120
           LQDGFGFLRS +ANYL GPDDIY+SPSQI+ FSLKTGDTVEG IR P+EGERYFALLKVN
Sbjct: 61  LQDGFGFLRSANANYLPGPDDIYISPSQIRRFSLKTGDTVEGPIRGPKEGERYFALLKVN 120

Query: 121 AINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIV 180
            INFD PE++R+K+HFDNLTPLYP++RF MEL  P +KD+S+RVIDL+AP+GKGQR LIV
Sbjct: 121 TINFDDPEKIRHKVHFDNLTPLYPNERFKMELEVPTSKDLSARVIDLVAPLGKGQRGLIV 180

Query: 181 APPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAA 240
           APPRTGKT+LLQNIAHSI  NHPECYLIVLLIDERPEEVTDMQRSV+GEV+SSTFDE A 
Sbjct: 181 APPRTGKTVLLQNIAHSITANHPECYLIVLLIDERPEEVTDMQRSVKGEVVSSTFDEPAT 240

Query: 241 RHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRP 300
           RHVQVAEMVI KAK LVE+G DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRP
Sbjct: 241 RHVQVAEMVIEKAKRLVEHGRDVVILLDSITRLGRAYNTVVPSSGKVLTGGVDANALQRP 300

Query: 301 KRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPA 360
           KRFFGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RK+ADKRIFP+
Sbjct: 301 KRFFGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKVADKRIFPS 360

Query: 361 MDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           MDI+KSGTRKEDLLV RQDLQK+F+LRRI++ M ++DAIEFLIDKLKQTK N DFF SMN
Sbjct: 361 MDILKSGTRKEDLLVPRQDLQKIFVLRRILAPMGTTDAIEFLIDKLKQTKTNGDFFDSMN 420


>gi|227823857|ref|YP_002827830.1| transcription termination factor Rho [Sinorhizobium fredii NGR234]
 gi|227342859|gb|ACP27077.1| transcription termination factor Rho [Sinorhizobium fredii NGR234]
          Length = 421

 Score =  720 bits (1859), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/420 (81%), Positives = 386/420 (91%)

Query: 1   MSEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEV 60
           M+EMKLQ+LKNK+PT LLAFAE LE+ENA+ MRKQELMF ILK L+ +++EIIGEGV+EV
Sbjct: 1   MAEMKLQDLKNKTPTDLLAFAEELEVENASTMRKQELMFGILKNLATQEIEIIGEGVVEV 60

Query: 61  LQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVN 120
           LQDGFGFLRS +ANYL GPDDIY+SPSQI+ FSLKTGDTVEG IR P+EGERYFALLKVN
Sbjct: 61  LQDGFGFLRSANANYLPGPDDIYISPSQIRRFSLKTGDTVEGPIRGPKEGERYFALLKVN 120

Query: 121 AINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIV 180
            INFD PE++R+K+HFDNLTPLYP++RF MEL  P +KD+S+RVIDL+AP+GKGQR LIV
Sbjct: 121 TINFDDPEKIRHKVHFDNLTPLYPNERFKMELEVPTSKDLSARVIDLVAPLGKGQRGLIV 180

Query: 181 APPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAA 240
           APPRTGKT+LLQNIAHSI  NHPECYLIVLLIDERPEEVTDMQRSV+GEV+SSTFDE A 
Sbjct: 181 APPRTGKTVLLQNIAHSITANHPECYLIVLLIDERPEEVTDMQRSVKGEVVSSTFDEPAT 240

Query: 241 RHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRP 300
           RHVQVAEMVI KAK LVE+G DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRP
Sbjct: 241 RHVQVAEMVIEKAKRLVEHGRDVVILLDSITRLGRAYNTVVPSSGKVLTGGVDANALQRP 300

Query: 301 KRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPA 360
           KRFFGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RK+ADKRIFPA
Sbjct: 301 KRFFGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKVADKRIFPA 360

Query: 361 MDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           MDI+KSGTRKEDLLV RQDLQK+F+LRRI++ M ++DAIEFLIDKLKQTK N DFF SMN
Sbjct: 361 MDILKSGTRKEDLLVPRQDLQKIFVLRRILAPMGTTDAIEFLIDKLKQTKTNGDFFDSMN 420


>gi|254707417|ref|ZP_05169245.1| transcription termination factor Rho [Brucella pinnipedialis
           M163/99/10]
 gi|261314901|ref|ZP_05954098.1| transcription termination factor Rho [Brucella pinnipedialis
           M163/99/10]
 gi|261303927|gb|EEY07424.1| transcription termination factor Rho [Brucella pinnipedialis
           M163/99/10]
          Length = 421

 Score =  720 bits (1859), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/420 (81%), Positives = 385/420 (91%)

Query: 1   MSEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEV 60
           M EMKLQELKNK+P +LLAFAE+LE+ENA+ MRKQELMF+ILK L+ +DVEIIGEGV+EV
Sbjct: 1   MQEMKLQELKNKTPVELLAFAETLEVENASAMRKQELMFAILKKLAAQDVEIIGEGVVEV 60

Query: 61  LQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVN 120
           LQDGFGFLRS DANYL GPDDIY+SPSQ++ FSLKTGDTVEG IR P+EGERYFALLKVN
Sbjct: 61  LQDGFGFLRSADANYLPGPDDIYISPSQLRRFSLKTGDTVEGPIRGPKEGERYFALLKVN 120

Query: 121 AINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIV 180
            INF+ PE++R+K+HFDNLTPLYP++RF MEL  P +KD+S RVIDL+AP+GKGQR LIV
Sbjct: 121 TINFEDPEKIRHKVHFDNLTPLYPNERFKMELEVPTSKDLSPRVIDLVAPLGKGQRGLIV 180

Query: 181 APPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAA 240
           APPRTGKT+LLQNIAHSI  NHPECYLIVLLIDERPEEVTDMQRSV+GEVISSTFDE AA
Sbjct: 181 APPRTGKTVLLQNIAHSITANHPECYLIVLLIDERPEEVTDMQRSVKGEVISSTFDEPAA 240

Query: 241 RHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRP 300
           RHVQVAEMVI KAK LVE+G DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRP
Sbjct: 241 RHVQVAEMVIEKAKRLVEHGRDVVILLDSITRLGRAYNTVVPSSGKVLTGGVDANALQRP 300

Query: 301 KRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPA 360
           KRFFGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RK+ADKRIFPA
Sbjct: 301 KRFFGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKVADKRIFPA 360

Query: 361 MDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           MDI KSGTRKEDLLV R DLQK+F+LRRI++ M ++DAIEFLIDKLKQTK N +FF SMN
Sbjct: 361 MDIFKSGTRKEDLLVPRADLQKIFVLRRILAPMGTTDAIEFLIDKLKQTKSNAEFFDSMN 420


>gi|306842821|ref|ZP_07475461.1| transcription termination factor Rho [Brucella sp. BO2]
 gi|306287015|gb|EFM58526.1| transcription termination factor Rho [Brucella sp. BO2]
          Length = 421

 Score =  719 bits (1857), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/420 (81%), Positives = 385/420 (91%)

Query: 1   MSEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEV 60
           M EMKLQELKNK+P +LLAFAE+LE+ENA+ MRKQELMF+ILK L+ +DVEIIGEGV+EV
Sbjct: 1   MQEMKLQELKNKTPVELLAFAETLEVENASAMRKQELMFAILKKLAAQDVEIIGEGVVEV 60

Query: 61  LQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVN 120
           LQDGFGFLRS DANYL GPDDIY+SPSQ++ FSLKTGDTVEG IR P+EGERYFALLKVN
Sbjct: 61  LQDGFGFLRSADANYLPGPDDIYISPSQLRRFSLKTGDTVEGPIRGPKEGERYFALLKVN 120

Query: 121 AINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIV 180
            INF+ PE++R+K+HFDNLTPLYP++RF MEL  P +KD+S RVIDL+AP+GKGQR LIV
Sbjct: 121 TINFEDPEKIRHKVHFDNLTPLYPNERFKMELEVPTSKDLSPRVIDLVAPLGKGQRGLIV 180

Query: 181 APPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAA 240
           APPRTGKT+LLQNI HSI  NHPECYLIVLLIDERPEEVTDMQRSV+GEVISSTFDE AA
Sbjct: 181 APPRTGKTVLLQNIVHSITANHPECYLIVLLIDERPEEVTDMQRSVKGEVISSTFDEPAA 240

Query: 241 RHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRP 300
           RHVQVAEMVI KAK LVE+G DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRP
Sbjct: 241 RHVQVAEMVIEKAKRLVEHGRDVVILLDSITRLGRAYNTVVPSSGKVLTGGVDANALQRP 300

Query: 301 KRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPA 360
           KRFFGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RK+ADKRIFPA
Sbjct: 301 KRFFGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKVADKRIFPA 360

Query: 361 MDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           MDI+KSGTRKEDLLV R DLQK+F+LRRI++ M ++DAIEFLIDKLKQTK N +FF SMN
Sbjct: 361 MDILKSGTRKEDLLVPRADLQKIFVLRRILAPMGTTDAIEFLIDKLKQTKSNAEFFDSMN 420


>gi|294851293|ref|ZP_06791966.1| transcription termination factor Rho [Brucella sp. NVSL 07-0026]
 gi|294819882|gb|EFG36881.1| transcription termination factor Rho [Brucella sp. NVSL 07-0026]
          Length = 421

 Score =  719 bits (1857), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/420 (81%), Positives = 386/420 (91%)

Query: 1   MSEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEV 60
           M EMKLQELKNK+P +LLAFAE+LE+ENA+ MRKQELMF+ILK L+ +DVEIIGEGV+EV
Sbjct: 1   MQEMKLQELKNKTPVELLAFAETLEVENASAMRKQELMFAILKKLAAQDVEIIGEGVVEV 60

Query: 61  LQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVN 120
           LQDGFGFLRS DANYL GPDDIY+SPSQ++ FSLKTGDTVEG IR P+EGERYFALLKVN
Sbjct: 61  LQDGFGFLRSADANYLPGPDDIYISPSQLRRFSLKTGDTVEGPIRGPKEGERYFALLKVN 120

Query: 121 AINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIV 180
            INF+ PE++R+K+HFDNLTPLYP++RF MEL  P +KD+S RVIDL+AP+GKGQR LIV
Sbjct: 121 TINFEDPEKIRHKVHFDNLTPLYPNERFKMELEVPTSKDLSPRVIDLVAPLGKGQRGLIV 180

Query: 181 APPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAA 240
           APPRTGKT+LLQNIAHSI  NHPECYLIVLLIDERPEEVTDMQRSV+GEVISSTFDE AA
Sbjct: 181 APPRTGKTVLLQNIAHSITANHPECYLIVLLIDERPEEVTDMQRSVKGEVISSTFDEPAA 240

Query: 241 RHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRP 300
           RHVQVAE+VI KAK LVE+G DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRP
Sbjct: 241 RHVQVAEIVIEKAKRLVEHGRDVVILLDSITRLGRAYNTVVPSSGKVLTGGVDANALQRP 300

Query: 301 KRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPA 360
           KRFFGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RK+ADKRIFPA
Sbjct: 301 KRFFGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKVADKRIFPA 360

Query: 361 MDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           MDI+KSGTRKEDLLV R DLQK+F+LRRI++ M ++DAIEFLIDKLKQTK N +FF SMN
Sbjct: 361 MDILKSGTRKEDLLVPRADLQKIFVLRRILAPMGTTDAIEFLIDKLKQTKSNAEFFDSMN 420


>gi|163844082|ref|YP_001628486.1| transcription termination factor Rho [Brucella suis ATCC 23445]
 gi|163674805|gb|ABY38916.1| transcription termination factor Rho [Brucella suis ATCC 23445]
          Length = 421

 Score =  717 bits (1852), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/420 (81%), Positives = 385/420 (91%)

Query: 1   MSEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEV 60
           M EMKLQELKNK+P +LLAFAE+LE+ENA+ MRKQELMF+ILK L+ +DVEIIGEGV+EV
Sbjct: 1   MQEMKLQELKNKTPVELLAFAETLEVENASAMRKQELMFAILKKLAAQDVEIIGEGVVEV 60

Query: 61  LQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVN 120
           LQDGFGFLRS DANYL GPDDIY+SPSQ++ FSLKTGDTVEG IR P+EGERYFALLKVN
Sbjct: 61  LQDGFGFLRSADANYLPGPDDIYISPSQLRRFSLKTGDTVEGPIRGPKEGERYFALLKVN 120

Query: 121 AINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIV 180
            INF+ PE++ +K+HFDNLTPLYP++RF MEL  P +KD+S RVIDL+AP+GKGQR LIV
Sbjct: 121 TINFEDPEKICHKVHFDNLTPLYPNERFKMELEVPTSKDLSPRVIDLVAPLGKGQRGLIV 180

Query: 181 APPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAA 240
           APPRTGKT+LLQNIAHSI  NHPECYLIVLLIDERPEEVTDMQRSV+GEVISSTFDE AA
Sbjct: 181 APPRTGKTVLLQNIAHSITANHPECYLIVLLIDERPEEVTDMQRSVKGEVISSTFDEPAA 240

Query: 241 RHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRP 300
           RHVQVAEMVI KAK LVE+G DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRP
Sbjct: 241 RHVQVAEMVIEKAKRLVEHGRDVVILLDSITRLGRAYNTVVPSSGKVLTGGVDANALQRP 300

Query: 301 KRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPA 360
           KRFFGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RK+ADKRIFPA
Sbjct: 301 KRFFGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKVADKRIFPA 360

Query: 361 MDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           MDI+KSGTRKEDLLV R DLQK+F+LRRI++ M ++DAIEFLIDKLKQTK N +FF SMN
Sbjct: 361 MDILKSGTRKEDLLVPRADLQKIFVLRRILAPMGTTDAIEFLIDKLKQTKSNAEFFDSMN 420


>gi|307211525|gb|EFN87613.1| Transcription termination factor rho [Harpegnathos saltator]
          Length = 743

 Score =  717 bits (1850), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/420 (81%), Positives = 386/420 (91%)

Query: 1   MSEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEV 60
           M EMKLQELK+K+P +LLAFAE LE+ENAN MRKQELMF+ILK L+ +++EIIGEGV+E+
Sbjct: 323 MQEMKLQELKSKTPVELLAFAEELEVENANAMRKQELMFAILKKLALQEIEIIGEGVVEI 382

Query: 61  LQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVN 120
           LQDGFGFLRS DANYL GPDDIY+SPSQI+ FSLKTGDTVEG IR+P+EGERYFALLKVN
Sbjct: 383 LQDGFGFLRSADANYLPGPDDIYLSPSQIRRFSLKTGDTVEGPIRSPKEGERYFALLKVN 442

Query: 121 AINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIV 180
            INF+ P+ +R+KIHFDNLTPLYP++R  ME++NP  KD+S RVIDL+AP+GKGQR LIV
Sbjct: 443 TINFEDPDTIRHKIHFDNLTPLYPNERLRMEMDNPTGKDMSQRVIDLVAPLGKGQRGLIV 502

Query: 181 APPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAA 240
           APPRTGKT+LLQNIAHSI  NHPECYLIVLLIDERPEEVTDMQRSV+GEV+SSTFDE A+
Sbjct: 503 APPRTGKTVLLQNIAHSITANHPECYLIVLLIDERPEEVTDMQRSVKGEVVSSTFDEPAS 562

Query: 241 RHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRP 300
           RHVQVAEMVI KAK LVE+G DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRP
Sbjct: 563 RHVQVAEMVIEKAKRLVEHGRDVVILLDSITRLGRAYNTVVPSSGKVLTGGVDANALQRP 622

Query: 301 KRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPA 360
           KRFFGAARNI+EGGSLTII TALVDTGSRMDEVIFEEFKGTGNSEIVL+RKIADKRIFPA
Sbjct: 623 KRFFGAARNIEEGGSLTIIATALVDTGSRMDEVIFEEFKGTGNSEIVLDRKIADKRIFPA 682

Query: 361 MDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           MDI+KSGTRKEDLLV RQDLQK+F+LRRI+S M ++DAIEFLIDKLKQTK N +FF SMN
Sbjct: 683 MDILKSGTRKEDLLVARQDLQKIFVLRRILSPMGTTDAIEFLIDKLKQTKTNSEFFDSMN 742


>gi|240851404|ref|YP_002972807.1| transcription termination factor Rho [Bartonella grahamii as4aup]
 gi|240268527|gb|ACS52115.1| transcription termination factor Rho [Bartonella grahamii as4aup]
          Length = 421

 Score =  716 bits (1849), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/420 (80%), Positives = 390/420 (92%)

Query: 1   MSEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEV 60
           M +MKLQELK+K+P +L++FAE+LE+ENA++MRKQELMF+ILK L+ +DVEIIGEGV+EV
Sbjct: 1   MQKMKLQELKSKNPVELVSFAETLEVENASLMRKQELMFAILKKLALQDVEIIGEGVVEV 60

Query: 61  LQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVN 120
           LQDGFGFLRS DANYL GPDDIY+SP+QI+SFSLKTGDT+EG IR+P+EGERYFALLK+N
Sbjct: 61  LQDGFGFLRSADANYLPGPDDIYLSPAQIQSFSLKTGDTIEGPIRSPKEGERYFALLKIN 120

Query: 121 AINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIV 180
            INF+ PE++R KIHFDNLTPLY ++RF ME+ +P  KD+SSRVIDLI+P+GKGQR LIV
Sbjct: 121 TINFEKPEKIRYKIHFDNLTPLYSNERFQMEIQDPTEKDMSSRVIDLISPLGKGQRGLIV 180

Query: 181 APPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAA 240
           APPRTGKT+LLQNIAHSI  NHPECYLIVLLIDERPEEVTDMQRSV+GEV+SSTFDE A 
Sbjct: 181 APPRTGKTVLLQNIAHSITTNHPECYLIVLLIDERPEEVTDMQRSVKGEVVSSTFDEPAI 240

Query: 241 RHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRP 300
           RHVQVAEMVI KAK LVEYG DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRP
Sbjct: 241 RHVQVAEMVIEKAKRLVEYGRDVVILLDSITRLGRAYNTVVPSSGKVLTGGVDANALQRP 300

Query: 301 KRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPA 360
           KRFFGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RK+ADKRIFPA
Sbjct: 301 KRFFGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKVADKRIFPA 360

Query: 361 MDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           MDI+KSGTRKE+LLVERQDL K+F+LRRI++SMN +DAIEFLIDKLKQTK+N +FF SMN
Sbjct: 361 MDILKSGTRKEELLVERQDLHKIFVLRRILASMNVTDAIEFLIDKLKQTKNNSEFFDSMN 420


>gi|148559193|ref|YP_001259869.1| transcription termination factor Rho [Brucella ovis ATCC 25840]
 gi|148370450|gb|ABQ60429.1| transcription termination factor Rho [Brucella ovis ATCC 25840]
          Length = 418

 Score =  714 bits (1842), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/417 (81%), Positives = 383/417 (91%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           MKLQELKNK+P +LLAFAE+LE+ENA+ MRKQELMF+ILK L+ +DVEIIGEGV+EVLQD
Sbjct: 1   MKLQELKNKTPVELLAFAETLEVENASAMRKQELMFAILKKLAAQDVEIIGEGVVEVLQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS DANYL GPDDIY+SPSQ++ FSLKTGDTVEG IR P+EGERYFALLKVN IN
Sbjct: 61  GFGFLRSADANYLPGPDDIYISPSQLRRFSLKTGDTVEGPIRGPKEGERYFALLKVNTIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           F+ PE++ +K+HFDNLTPLYP++RF MEL  P +KD+S RVIDL+AP+GKGQR LIVAPP
Sbjct: 121 FEDPEKIGHKVHFDNLTPLYPNERFKMELEVPTSKDLSPRVIDLVAPLGKGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           RTGKT+LLQNIAHSI  NHPECYLIVLLIDERPEEVTDMQRSV+GEVISSTFDE AARHV
Sbjct: 181 RTGKTVLLQNIAHSITANHPECYLIVLLIDERPEEVTDMQRSVKGEVISSTFDEPAARHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+G DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHGRDVVILLDSITRLGRAYNTVVPSSGKVLTGGVDANALQRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RK+ADKRIFPAMDI
Sbjct: 301 FGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKVADKRIFPAMDI 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           +KSGTRKEDLLV R DLQK+F+LRRI++ M ++DAIEFLIDKLKQTK N +FF SMN
Sbjct: 361 LKSGTRKEDLLVPRADLQKIFVLRRILAPMGTTDAIEFLIDKLKQTKSNAEFFDSMN 417


>gi|319409466|emb|CBI83115.1| transcription termination factor rho [Bartonella schoenbuchensis
           R1]
          Length = 421

 Score =  712 bits (1838), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/420 (80%), Positives = 385/420 (91%)

Query: 1   MSEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEV 60
           M EMKLQELK+K+P +L+ FAE+LE+ENA++MRKQELMF+ILK L+ +DVEIIGEGV+EV
Sbjct: 1   MQEMKLQELKSKNPVELVTFAETLEVENASLMRKQELMFAILKKLALQDVEIIGEGVVEV 60

Query: 61  LQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVN 120
           LQDGFGFLRS DANYL GPDDIY+SP+QI+SFSLKTGDTVEG IR P+EGERYFALLK+N
Sbjct: 61  LQDGFGFLRSADANYLPGPDDIYLSPAQIQSFSLKTGDTVEGPIRGPKEGERYFALLKIN 120

Query: 121 AINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIV 180
            INF+ PE++R KIHFDNLTPLY ++RF ME+ +  NKD+SSRV+DLI+P+GKGQR LIV
Sbjct: 121 TINFEDPEKIRYKIHFDNLTPLYSNERFQMEMQDSTNKDMSSRVVDLISPLGKGQRGLIV 180

Query: 181 APPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAA 240
           APPRTGKT+LLQNIAHSI  NHPECYLIVLLIDERPEEVTDMQRSV GEVISSTFDE A 
Sbjct: 181 APPRTGKTVLLQNIAHSITTNHPECYLIVLLIDERPEEVTDMQRSVTGEVISSTFDEPAI 240

Query: 241 RHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRP 300
           RHVQVAEMVI KAK LVEYG DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRP
Sbjct: 241 RHVQVAEMVIEKAKRLVEYGRDVVILLDSITRLGRAYNTVVPSSGKVLTGGVDANALQRP 300

Query: 301 KRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPA 360
           KRFFGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RK+ADKRIFPA
Sbjct: 301 KRFFGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKVADKRIFPA 360

Query: 361 MDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           MD++KSGTRKEDLLV RQDL K+F+LRRI++ MN +DAIEFLIDKLKQTK+N +FF SMN
Sbjct: 361 MDVLKSGTRKEDLLVARQDLHKIFVLRRILAPMNVTDAIEFLIDKLKQTKNNSEFFDSMN 420


>gi|163869380|ref|YP_001610636.1| transcription termination factor Rho [Bartonella tribocorum CIP
           105476]
 gi|161019083|emb|CAK02641.1| transcription termination factor rho [Bartonella tribocorum CIP
           105476]
          Length = 421

 Score =  711 bits (1836), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/420 (80%), Positives = 388/420 (92%)

Query: 1   MSEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEV 60
           M +MKLQELK+K+P +L++FAE+LE+ENA++MRKQELMF+ILK L+ +DVEIIGEGV+EV
Sbjct: 1   MQKMKLQELKSKNPVELVSFAETLEVENASLMRKQELMFAILKKLALQDVEIIGEGVVEV 60

Query: 61  LQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVN 120
           LQDGFGFLRS DANYL GPDDIY+SP+QI+SFSLKTGDT+EG IR+P+EGERYFALLK+N
Sbjct: 61  LQDGFGFLRSADANYLPGPDDIYLSPAQIQSFSLKTGDTIEGPIRSPKEGERYFALLKIN 120

Query: 121 AINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIV 180
            INF+ PE++R KIHFDNLTPLY ++RF ME+ +P  KD+SSRVIDLI+P+GKGQR LIV
Sbjct: 121 TINFEKPEKIRYKIHFDNLTPLYSNERFQMEIQDPTEKDMSSRVIDLISPLGKGQRGLIV 180

Query: 181 APPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAA 240
           APPRTGKT+LLQNIAHSI  NHPECYLIVLLIDERPEEVTDMQRSV+GEV+SSTFDE A 
Sbjct: 181 APPRTGKTVLLQNIAHSITTNHPECYLIVLLIDERPEEVTDMQRSVKGEVVSSTFDEPAI 240

Query: 241 RHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRP 300
           RHVQVAEMVI KAK LVEYG DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRP
Sbjct: 241 RHVQVAEMVIEKAKRLVEYGRDVVILLDSITRLGRAYNTVVPSSGKVLTGGVDANALQRP 300

Query: 301 KRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPA 360
           KRFFGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RK+ADKRIFPA
Sbjct: 301 KRFFGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKVADKRIFPA 360

Query: 361 MDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           MDI+KSGTRKE+LLV RQDL K+F+LRRI++ MN +DAIEFLIDKLKQTK+N +FF SMN
Sbjct: 361 MDILKSGTRKEELLVARQDLHKIFVLRRILAPMNVTDAIEFLIDKLKQTKNNSEFFDSMN 420


>gi|49476319|ref|YP_034360.1| transcription termination factor Rho [Bartonella henselae str.
           Houston-1]
 gi|49239127|emb|CAF28431.1| Transcription termination factor rho [Bartonella henselae str.
           Houston-1]
          Length = 421

 Score =  711 bits (1835), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/420 (80%), Positives = 387/420 (92%)

Query: 1   MSEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEV 60
           M EMKLQELK+K+P +L+ FAE+LE+ENA++MRKQELMF+ILK L+ +DVEIIGEGV+EV
Sbjct: 1   MQEMKLQELKSKNPVELVFFAETLEVENASLMRKQELMFAILKKLALQDVEIIGEGVVEV 60

Query: 61  LQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVN 120
           LQDGFGFLRS DANYL GPDDIY+SP+QI+SFSLKTGDT+EG IR+P+EGERYFALLK+N
Sbjct: 61  LQDGFGFLRSADANYLPGPDDIYLSPAQIQSFSLKTGDTIEGPIRSPKEGERYFALLKIN 120

Query: 121 AINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIV 180
            INF+ PE++R KIHFDNLTPLY ++RF ME+ +P  KD+SSRVIDLI+P+GKGQR LIV
Sbjct: 121 TINFENPEKIRYKIHFDNLTPLYSNERFQMEIQDPTEKDMSSRVIDLISPLGKGQRGLIV 180

Query: 181 APPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAA 240
           APPRTGKT+LLQNIAHSI  NHPECYLIVLLIDERPEEVTDMQRSV+GEV+SSTFDE A 
Sbjct: 181 APPRTGKTVLLQNIAHSITTNHPECYLIVLLIDERPEEVTDMQRSVKGEVVSSTFDEPAI 240

Query: 241 RHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRP 300
           RHVQVAEMVI KAK LVEYG DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRP
Sbjct: 241 RHVQVAEMVIEKAKRLVEYGRDVVILLDSITRLGRAYNTVVPSSGKVLTGGVDANALQRP 300

Query: 301 KRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPA 360
           KRFFGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RK+ADKRIFPA
Sbjct: 301 KRFFGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKVADKRIFPA 360

Query: 361 MDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           MDI+KSGTRKE+LLV RQDL K+F+LRRI++ MN +DAIEFLIDKLKQTK+N +FF SMN
Sbjct: 361 MDILKSGTRKEELLVARQDLHKIFVLRRILAPMNVTDAIEFLIDKLKQTKNNSEFFDSMN 420


>gi|49474830|ref|YP_032872.1| transcription termination factor Rho [Bartonella quintana str.
           Toulouse]
 gi|49240334|emb|CAF26816.1| Transcription termination factor rho [Bartonella quintana str.
           Toulouse]
          Length = 421

 Score =  708 bits (1828), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/420 (80%), Positives = 386/420 (91%)

Query: 1   MSEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEV 60
           M  MKLQELK+K+P +L++FAE+LE+ENA++MRKQELMF+ILK L+ +D+EIIGEGV+EV
Sbjct: 1   MQGMKLQELKSKNPVELVSFAETLEVENASLMRKQELMFAILKKLASQDIEIIGEGVVEV 60

Query: 61  LQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVN 120
           LQDGFGFLRS DANYL GPDDIY+SP+QI+SFSLKTGDTVEG IR+P+EGERYFALLK+N
Sbjct: 61  LQDGFGFLRSADANYLPGPDDIYLSPAQIQSFSLKTGDTVEGPIRSPKEGERYFALLKIN 120

Query: 121 AINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIV 180
            INF+ PE++R KIHFDNL PLY ++RF ME+ +P  KD+SSRVIDLI+P+GKGQR LIV
Sbjct: 121 TINFEDPEKIRYKIHFDNLIPLYSNERFQMEIQDPTEKDMSSRVIDLISPLGKGQRGLIV 180

Query: 181 APPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAA 240
           APPRTGKT+LLQNIAHSI  NHPECYLIVLLIDERPEEVTDMQRSV+GEV+SSTFDE A 
Sbjct: 181 APPRTGKTVLLQNIAHSITTNHPECYLIVLLIDERPEEVTDMQRSVKGEVVSSTFDEPAM 240

Query: 241 RHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRP 300
           RHVQVAEMVI KAK LVEYG DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRP
Sbjct: 241 RHVQVAEMVIEKAKRLVEYGRDVVILLDSITRLGRAYNTVVPSSGKVLTGGVDANALQRP 300

Query: 301 KRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPA 360
           KRFFGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RK+ADKRIFPA
Sbjct: 301 KRFFGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKVADKRIFPA 360

Query: 361 MDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           MDI+KSGTRKE+LLV RQDL K+F+LRRI++ MN +DAIEFLIDKLKQTK+N +FF SMN
Sbjct: 361 MDILKSGTRKEELLVARQDLHKIFVLRRILAPMNVTDAIEFLIDKLKQTKNNSEFFDSMN 420


>gi|319406399|emb|CBI80040.1| transcription termination factor rho [Bartonella sp. AR 15-3]
          Length = 421

 Score =  708 bits (1827), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/420 (80%), Positives = 386/420 (91%)

Query: 1   MSEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEV 60
           M EMKLQELK+K+P +L++FAE+LE+ENA++MRKQELMF+ILK L+ + VEIIGEGV+EV
Sbjct: 1   MQEMKLQELKSKNPVELVSFAETLEVENASLMRKQELMFAILKKLTLQKVEIIGEGVVEV 60

Query: 61  LQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVN 120
           LQDGFGFLRS DANYL GPDDIY+SP+QI++FSLKTGDTVEG IR P+EGERYFALLKVN
Sbjct: 61  LQDGFGFLRSADANYLPGPDDIYLSPTQIQNFSLKTGDTVEGPIRGPKEGERYFALLKVN 120

Query: 121 AINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIV 180
            INF+ PE++R KIHFDNLTPLY ++RF ME+ NP +KD+SSRVIDLI+P+GKGQR LIV
Sbjct: 121 TINFEDPEKIRYKIHFDNLTPLYSNERFQMEVQNPTDKDMSSRVIDLISPLGKGQRGLIV 180

Query: 181 APPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAA 240
           APPRTGKT+LLQNIAHSI  NHPECYLIVLLIDERPEEVTDMQRSV+GEVISSTFDE A 
Sbjct: 181 APPRTGKTVLLQNIAHSITTNHPECYLIVLLIDERPEEVTDMQRSVKGEVISSTFDEPAI 240

Query: 241 RHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRP 300
           RHVQVAEMVI KAK LVEYG DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRP
Sbjct: 241 RHVQVAEMVIEKAKRLVEYGRDVVILLDSITRLGRAYNTVVPSSGKVLTGGVDANALQRP 300

Query: 301 KRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPA 360
           KRFFGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RK+ADKR FPA
Sbjct: 301 KRFFGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKVADKRTFPA 360

Query: 361 MDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           MDI+KSGTRKE+LLV RQDL K+F+LRRI++ M+ +DAIEFLIDKLKQTK+N +FF SMN
Sbjct: 361 MDILKSGTRKEELLVARQDLHKIFVLRRILAPMSVTDAIEFLIDKLKQTKNNSEFFDSMN 420


>gi|319899519|ref|YP_004159616.1| transcription termination factor rho [Bartonella clarridgeiae 73]
 gi|319403487|emb|CBI77067.1| transcription termination factor rho [Bartonella clarridgeiae 73]
          Length = 421

 Score =  707 bits (1826), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/420 (80%), Positives = 386/420 (91%)

Query: 1   MSEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEV 60
           M EMKLQELK+K+P +L++FAE+LE+ENA++MRKQELMF+ILK L+ ++VEIIGEGV+EV
Sbjct: 1   MQEMKLQELKSKNPVELVSFAETLEVENASLMRKQELMFAILKKLTLQNVEIIGEGVVEV 60

Query: 61  LQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVN 120
           LQDGFGFLRS DANYL GPDDIY+SP+QI+S SLKTGDTVEG IR P+EGERYFALLKVN
Sbjct: 61  LQDGFGFLRSADANYLPGPDDIYISPTQIQSSSLKTGDTVEGPIRGPKEGERYFALLKVN 120

Query: 121 AINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIV 180
            INF+ PE++R KIHFDNLTPLY ++RF ME+ +P +KD+SSRVIDLI+P+GKGQR LIV
Sbjct: 121 TINFEDPEKIRYKIHFDNLTPLYSNERFQMEVQDPTDKDMSSRVIDLISPLGKGQRGLIV 180

Query: 181 APPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAA 240
           APPRTGKT+LLQNIAHSI  NHPECYLIVLLIDERPEEVTDMQRSV+GEV+SSTFDE A 
Sbjct: 181 APPRTGKTVLLQNIAHSITTNHPECYLIVLLIDERPEEVTDMQRSVKGEVVSSTFDEPAI 240

Query: 241 RHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRP 300
           RHVQVAEMVI KAK LVEYG DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRP
Sbjct: 241 RHVQVAEMVIEKAKRLVEYGRDVVILLDSITRLGRAYNTVVPSSGKVLTGGVDANALQRP 300

Query: 301 KRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPA 360
           KRFFGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RK+ADKR FPA
Sbjct: 301 KRFFGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKVADKRTFPA 360

Query: 361 MDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           MDI+KSGTRKEDLLV RQDL K+F+LRRI++ M+ +DAIEFLIDKLKQTK+N +FF SMN
Sbjct: 361 MDILKSGTRKEDLLVARQDLHKIFVLRRILAPMSVTDAIEFLIDKLKQTKNNSEFFDSMN 420


>gi|319407873|emb|CBI81526.1| transcription termination factor rho (modular protein) [Bartonella
           sp. 1-1C]
          Length = 621

 Score =  707 bits (1825), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/418 (80%), Positives = 386/418 (92%)

Query: 3   EMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQ 62
           +MKLQELK+K+P +L++FAE+LE+ENA++MRKQELMF+ILK L+ ++VEIIGEGV+EVLQ
Sbjct: 203 QMKLQELKSKNPVELVSFAETLEVENASLMRKQELMFAILKKLTLQNVEIIGEGVVEVLQ 262

Query: 63  DGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAI 122
           DGFGFLRS DANYL GPDDIY+SP+QI++FSLKTGDTVEG IR P+EGERYFALLKVN I
Sbjct: 263 DGFGFLRSADANYLPGPDDIYLSPTQIQNFSLKTGDTVEGPIRGPKEGERYFALLKVNKI 322

Query: 123 NFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAP 182
           NF+ PE++R KIHFDNLTPLY ++RF ME+ NP +KD+SSRVIDLI+P+GKGQR LIVAP
Sbjct: 323 NFEDPEKIRYKIHFDNLTPLYSNERFQMEVQNPTDKDMSSRVIDLISPLGKGQRGLIVAP 382

Query: 183 PRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARH 242
           PRTGKT+LLQNIAHSI  NHPECYLIVLLIDERPEEVTDMQRSV+GEV+SSTFDE A RH
Sbjct: 383 PRTGKTVLLQNIAHSITTNHPECYLIVLLIDERPEEVTDMQRSVKGEVVSSTFDEPAIRH 442

Query: 243 VQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKR 302
           VQVAEMVI KAK LVEYG DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRPKR
Sbjct: 443 VQVAEMVIEKAKRLVEYGRDVVILLDSITRLGRAYNTVVPSSGKVLTGGVDANALQRPKR 502

Query: 303 FFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMD 362
           FFGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RK+ADKR FPAMD
Sbjct: 503 FFGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKVADKRTFPAMD 562

Query: 363 IIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           IIKSGTRKEDLLV RQDL K+F+LRRI++ M+ +DAIEFLIDKLKQTK+N +FF SMN
Sbjct: 563 IIKSGTRKEDLLVARQDLHKIFVLRRILAPMSVTDAIEFLIDKLKQTKNNSEFFDSMN 620



 Score =  333 bits (853), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 154/202 (76%), Positives = 184/202 (91%)

Query: 1   MSEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEV 60
           M EMKLQELK+K+P +L++FAE+LE+ENA++MRKQELMF+ILK L+ ++VEIIGEGV+EV
Sbjct: 1   MQEMKLQELKSKNPVELVSFAETLEVENASLMRKQELMFAILKKLTLQNVEIIGEGVVEV 60

Query: 61  LQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVN 120
           LQDGFGFLRS DANYL GPDDIY+SP+QI++FSLKTGDTVEG IR P+EGERYFALLKVN
Sbjct: 61  LQDGFGFLRSADANYLPGPDDIYLSPTQIQNFSLKTGDTVEGPIRGPKEGERYFALLKVN 120

Query: 121 AINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIV 180
            INF+ PE++R KIHFDNLTPLY ++RF ME+ NP +KD+SSRVIDLI+P+GKGQR LIV
Sbjct: 121 KINFEDPEKIRYKIHFDNLTPLYSNERFQMEVQNPTDKDMSSRVIDLISPLGKGQRGLIV 180

Query: 181 APPRTGKTILLQNIAHSIKKNH 202
           APPRTGKT+LLQNIAHSI  NH
Sbjct: 181 APPRTGKTVLLQNIAHSITTNH 202


>gi|13473778|ref|NP_105346.1| transcription termination factor Rho [Mesorhizobium loti
           MAFF303099]
 gi|14024529|dbj|BAB51132.1| transcription termination factor Rho [Mesorhizobium loti
           MAFF303099]
          Length = 418

 Score =  707 bits (1825), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/417 (81%), Positives = 380/417 (91%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           MKL E KNK P +L+A+AESLE+ENA+VMRKQELMF+ILK L+ +DVEIIG+GV+EVLQD
Sbjct: 1   MKLTEFKNKKPPELIAYAESLEVENASVMRKQELMFAILKKLAAQDVEIIGDGVVEVLQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS +ANYL GPDDIY+SPSQI+ FSLKTGDTVEG IR+P+EGERYFALLKVN IN
Sbjct: 61  GFGFLRSANANYLPGPDDIYISPSQIRRFSLKTGDTVEGPIRSPKEGERYFALLKVNTIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           FD PE++R+KIHFDNLTPLYP  R  ME+  P +KDIS RVIDL+AP+GKGQR+LIVA P
Sbjct: 121 FDDPEKIRHKIHFDNLTPLYPTSRLKMEMEVPTSKDISPRVIDLVAPLGKGQRALIVAQP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           RTGKT+LLQNIAHSI  NHPECYLIVLLIDERPEEVTDMQRSV+GEV+SSTFDE A RHV
Sbjct: 181 RTGKTVLLQNIAHSITTNHPECYLIVLLIDERPEEVTDMQRSVKGEVVSSTFDEPAVRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+G DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHGRDVVILLDSITRLGRAYNTVVPSSGKVLTGGVDANALQRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RK+ADKRI+PAMDI
Sbjct: 301 FGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKVADKRIYPAMDI 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           +KSGTRKEDLLV RQDLQK+F+LRRI++ M ++DAIEFLIDKLKQTK N DFF SMN
Sbjct: 361 LKSGTRKEDLLVPRQDLQKIFVLRRILAPMGTTDAIEFLIDKLKQTKTNADFFDSMN 417


>gi|319404913|emb|CBI78514.1| transcription termination factor rho [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 421

 Score =  706 bits (1822), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/420 (80%), Positives = 386/420 (91%)

Query: 1   MSEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEV 60
           M EMKLQELK+K+P +L++FAE+LE+ENA++MRKQELMF+ILK L+ ++VEIIGEGV+EV
Sbjct: 1   MQEMKLQELKSKNPVELVSFAETLEVENASLMRKQELMFAILKKLTLQNVEIIGEGVVEV 60

Query: 61  LQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVN 120
           LQDGFGFLRS DANYL GPDDIY+SP+QI++FSLKTGDTVEG IR P+EGERYFALLKVN
Sbjct: 61  LQDGFGFLRSADANYLPGPDDIYLSPTQIQNFSLKTGDTVEGPIRGPKEGERYFALLKVN 120

Query: 121 AINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIV 180
            INF+ PE++R KIHFDNLTPLY ++RF ME+ NP +KD+SSRVIDLI+P+GKGQR LIV
Sbjct: 121 KINFEDPEKIRYKIHFDNLTPLYSNERFQMEVQNPTDKDMSSRVIDLISPLGKGQRGLIV 180

Query: 181 APPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAA 240
           APPRTGKT+LLQNIA SI  NHPECYLIVLLIDERPEEVTDMQRSV+GEV+SSTFDE A 
Sbjct: 181 APPRTGKTVLLQNIARSITTNHPECYLIVLLIDERPEEVTDMQRSVKGEVVSSTFDEPAI 240

Query: 241 RHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRP 300
           RHVQVAEMVI KAK LVEYG DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRP
Sbjct: 241 RHVQVAEMVIEKAKRLVEYGRDVVILLDSITRLGRAYNTVVPSSGKVLTGGVDANALQRP 300

Query: 301 KRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPA 360
           KRFFGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RK+ADKR FPA
Sbjct: 301 KRFFGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKVADKRTFPA 360

Query: 361 MDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           MDIIKSGTRKEDLLV RQDL K+F+LRRI++ M+ +DA+EFLIDKLKQTK+N +FF SMN
Sbjct: 361 MDIIKSGTRKEDLLVARQDLHKIFVLRRILAPMSVTDALEFLIDKLKQTKNNSEFFDSMN 420


>gi|121602564|ref|YP_988348.1| transcription termination factor Rho [Bartonella bacilliformis
           KC583]
 gi|120614741|gb|ABM45342.1| transcription termination factor Rho [Bartonella bacilliformis
           KC583]
          Length = 421

 Score =  705 bits (1820), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/420 (80%), Positives = 384/420 (91%)

Query: 1   MSEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEV 60
           M EMKLQELK+KSP +L++FAE+LE+ENA++MRKQELMF+ILK L+ +DVEIIGEGV+EV
Sbjct: 1   MQEMKLQELKSKSPVELISFAETLEVENASLMRKQELMFAILKKLALQDVEIIGEGVVEV 60

Query: 61  LQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVN 120
           LQDGFGFLRS DANYL GPDDIY+ PSQI+SFSLKTGDTVEG IR P+EGE YFALLKVN
Sbjct: 61  LQDGFGFLRSADANYLPGPDDIYILPSQIQSFSLKTGDTVEGPIRGPKEGEHYFALLKVN 120

Query: 121 AINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIV 180
            INF+ PE++R KIHFDNLTPLYP++ F ME+ +P  KDISSR++DLI+P+GKGQR LIV
Sbjct: 121 KINFEDPEKIRYKIHFDNLTPLYPNEPFRMEIQDPTEKDISSRIVDLISPLGKGQRGLIV 180

Query: 181 APPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAA 240
           APPRTGKT+LLQNIAHSI  NHPECYLIVLLIDERPEEVTDMQRSV+GEV+SSTFDE A 
Sbjct: 181 APPRTGKTVLLQNIAHSITTNHPECYLIVLLIDERPEEVTDMQRSVKGEVVSSTFDEPAI 240

Query: 241 RHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRP 300
           RHV+VAEMVI KAK LVEYG DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRP
Sbjct: 241 RHVRVAEMVIEKAKRLVEYGRDVVILLDSITRLGRAYNTVVPSSGKVLTGGVDANALQRP 300

Query: 301 KRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPA 360
           KRFFGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RK++DKRIFPA
Sbjct: 301 KRFFGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKVSDKRIFPA 360

Query: 361 MDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           MD++KSGTRKEDLLV RQDL K+F+LRRI++ MN +DA+EFLIDKLK TK+N +FF SMN
Sbjct: 361 MDVLKSGTRKEDLLVARQDLHKIFVLRRILAPMNITDAMEFLIDKLKHTKNNSEFFDSMN 420


>gi|260467196|ref|ZP_05813373.1| transcription termination factor Rho [Mesorhizobium opportunistum
           WSM2075]
 gi|259029049|gb|EEW30348.1| transcription termination factor Rho [Mesorhizobium opportunistum
           WSM2075]
          Length = 421

 Score =  705 bits (1819), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/420 (80%), Positives = 381/420 (90%)

Query: 1   MSEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEV 60
           M EMKL E KNK P +L+A+AESLE+ENA+VMRKQELMF+ILK L+ +++EIIG+GV+EV
Sbjct: 1   MQEMKLAEFKNKKPPELIAYAESLEVENASVMRKQELMFAILKKLAAQEIEIIGDGVVEV 60

Query: 61  LQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVN 120
           LQDGFGFLRS +ANYL GPDDIY+SPSQI+ FSLKTGDTVEG IR+P+EGERYFALLKVN
Sbjct: 61  LQDGFGFLRSANANYLPGPDDIYISPSQIRRFSLKTGDTVEGPIRSPKEGERYFALLKVN 120

Query: 121 AINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIV 180
            INFD PE++R+KIHFDNLTPLYP KR  ME++NP +KDIS RVIDL+APIGKGQR+LI 
Sbjct: 121 TINFDDPEKIRHKIHFDNLTPLYPTKRLKMEIDNPTSKDISPRVIDLVAPIGKGQRALIN 180

Query: 181 APPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAA 240
           A PRTGKT+L+QNIAHSI  NHPECYLIVLLIDERPEEVTDMQRSV+GEVISSTFDE A 
Sbjct: 181 AQPRTGKTVLMQNIAHSITANHPECYLIVLLIDERPEEVTDMQRSVKGEVISSTFDEPAV 240

Query: 241 RHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRP 300
           RHVQVAEMVI KAK LVE+G DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRP
Sbjct: 241 RHVQVAEMVIEKAKRLVEHGRDVVILLDSITRLGRAYNTVVPSSGKVLTGGVDANALQRP 300

Query: 301 KRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPA 360
           KRFFGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGN EI L+RK+ADKRI+PA
Sbjct: 301 KRFFGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNCEIQLDRKVADKRIYPA 360

Query: 361 MDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           MDI+KSGTRKEDLLV R DLQK+F+LRRI++ M ++DAIEFLIDKLKQTK N DFF SMN
Sbjct: 361 MDILKSGTRKEDLLVPRADLQKIFVLRRILAPMGTTDAIEFLIDKLKQTKTNADFFDSMN 420


>gi|319780611|ref|YP_004140087.1| transcription termination factor Rho [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317166499|gb|ADV10037.1| transcription termination factor Rho [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 421

 Score =  703 bits (1815), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/420 (80%), Positives = 380/420 (90%)

Query: 1   MSEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEV 60
           M EMKL E KNK P +L+A+AESLE+ENA+VMRKQELMF+ILK L+ +++EIIG+GV+EV
Sbjct: 1   MQEMKLAEFKNKKPPELIAYAESLEVENASVMRKQELMFAILKKLAAQEIEIIGDGVVEV 60

Query: 61  LQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVN 120
           LQDGFGFLRS +ANYL GPDDIY+SPSQI+ FSLKTGDTVEG IR+P+EGERYFALLKVN
Sbjct: 61  LQDGFGFLRSANANYLPGPDDIYISPSQIRRFSLKTGDTVEGPIRSPKEGERYFALLKVN 120

Query: 121 AINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIV 180
            INFD PE++R+KIHFDNLTPLYP KR  ME+ N   KDIS+RVIDL+APIGKGQR+LI 
Sbjct: 121 TINFDDPEKIRHKIHFDNLTPLYPTKRLKMEIENVTTKDISARVIDLVAPIGKGQRALIN 180

Query: 181 APPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAA 240
           A PRTGKT+L+QNIAHSI  NHPECYLIVLLIDERPEEVTDMQRSV+GEVISSTFDE A 
Sbjct: 181 AQPRTGKTVLMQNIAHSITANHPECYLIVLLIDERPEEVTDMQRSVKGEVISSTFDEPAV 240

Query: 241 RHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRP 300
           RHVQVAEMVI KAK LVE+G DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRP
Sbjct: 241 RHVQVAEMVIEKAKRLVEHGRDVVILLDSITRLGRAYNTVVPSSGKVLTGGVDANALQRP 300

Query: 301 KRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPA 360
           KRFFGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGN EI L+RK+ADKRI+PA
Sbjct: 301 KRFFGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNCEIQLDRKVADKRIYPA 360

Query: 361 MDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           MDI+KSGTRKEDLLV +QDLQK+F+LRRI++ M ++DAIEFLIDKLKQTK N DFF SMN
Sbjct: 361 MDILKSGTRKEDLLVSKQDLQKIFVLRRILAPMGTTDAIEFLIDKLKQTKTNADFFDSMN 420


>gi|328541698|ref|YP_004301807.1| transcription termination factor Rho protein [polymorphum gilvum
           SL003B-26A1]
 gi|326411450|gb|ADZ68513.1| Probable transcription termination factor Rho protein [Polymorphum
           gilvum SL003B-26A1]
          Length = 421

 Score =  696 bits (1796), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/420 (78%), Positives = 381/420 (90%)

Query: 1   MSEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEV 60
           M EMKL++LK K+PT+LLAFAE LE+ENA+ MRKQELMF+ILK L+ +DV+IIGEGV+EV
Sbjct: 1   MREMKLKDLKEKTPTELLAFAEELEVENASTMRKQELMFAILKRLAAQDVDIIGEGVVEV 60

Query: 61  LQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVN 120
           LQDGFGFLRSPDANYL GPDDIYVSPSQI+ FSL+TGDTVEG IR+P+EGERYFALLKVN
Sbjct: 61  LQDGFGFLRSPDANYLPGPDDIYVSPSQIRRFSLRTGDTVEGQIRSPKEGERYFALLKVN 120

Query: 121 AINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIV 180
            INF+ PE+ R+K+HFDNLTPLYPD+RF ME+ +P +KD+SSR+IDL+AP+GKGQR+LI 
Sbjct: 121 TINFEDPEKTRHKVHFDNLTPLYPDERFKMEIEDPTSKDLSSRIIDLVAPLGKGQRALIT 180

Query: 181 APPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAA 240
           APPRTGKT+ LQNIA SI  NHPECYLIVLLIDERPEEVTDMQR+V+GEV+SSTFDE AA
Sbjct: 181 APPRTGKTVFLQNIAKSITTNHPECYLIVLLIDERPEEVTDMQRTVKGEVVSSTFDEPAA 240

Query: 241 RHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRP 300
           RHVQVAEMVI KAK LVE+G DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRP
Sbjct: 241 RHVQVAEMVIEKAKRLVEHGRDVVILLDSITRLGRAYNTVVPSSGKVLTGGVDANALQRP 300

Query: 301 KRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPA 360
           KRFFGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEI+L+RKI+DKR+FPA
Sbjct: 301 KRFFGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIILDRKISDKRVFPA 360

Query: 361 MDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           +DI +SGTRKE+LLV    L+K F+LRRI++ M + DAIEFL+DKL+QTK N DFF SMN
Sbjct: 361 IDIQRSGTRKEELLVAPDKLKKTFVLRRILNPMGTVDAIEFLLDKLRQTKSNDDFFDSMN 420


>gi|114705486|ref|ZP_01438389.1| transcription termination factor Rho [Fulvimarina pelagi HTCC2506]
 gi|114538332|gb|EAU41453.1| transcription termination factor Rho [Fulvimarina pelagi HTCC2506]
          Length = 419

 Score =  694 bits (1790), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/418 (79%), Positives = 375/418 (89%), Gaps = 1/418 (0%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           MKLQ+LKNKS  +L+AFAE  E+ENA+V+RKQELMF+ILK L+ +D EIIGEGV+E+LQD
Sbjct: 1   MKLQDLKNKSAPELIAFAEENEVENASVLRKQELMFAILKQLASQDEEIIGEGVVEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GF FLRSPDANYL GPDDIYVSPSQI+ F LKTGDTVEG IR+P+EGERYFALLKVN IN
Sbjct: 61  GFAFLRSPDANYLPGPDDIYVSPSQIRKFQLKTGDTVEGPIRSPKEGERYFALLKVNTIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENK-DISSRVIDLIAPIGKGQRSLIVAP 182
           FD PE++R+K HFDNLTPLYPD+RF ME+ +P +K D+S RVIDL+AP+GKGQR LIVAP
Sbjct: 121 FDDPEKIRHKSHFDNLTPLYPDERFKMEIGDPTSKKDMSGRVIDLVAPLGKGQRGLIVAP 180

Query: 183 PRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARH 242
           PRTGKT+LLQNIAHSI  NHPECYLIVLLIDERPEEVTDMQRSV+GEV+SSTFDE A RH
Sbjct: 181 PRTGKTVLLQNIAHSITANHPECYLIVLLIDERPEEVTDMQRSVRGEVVSSTFDEPAQRH 240

Query: 243 VQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKR 302
           V VAEMVI KAK LVE+G DVVILLDSITRL RAYN  +PSSGK+LTGGVDANALQRPKR
Sbjct: 241 VAVAEMVIEKAKRLVEHGRDVVILLDSITRLGRAYNTTVPSSGKVLTGGVDANALQRPKR 300

Query: 303 FFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMD 362
           FFGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RK+ADKR +PAMD
Sbjct: 301 FFGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKVADKRTYPAMD 360

Query: 363 IIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           I+KSGTRKEDLL++R DLQK+F+LRRI+S M ++DAIEFL DKLK TK N DFF  MN
Sbjct: 361 ILKSGTRKEDLLIQRSDLQKIFVLRRILSQMGTTDAIEFLTDKLKATKTNADFFDQMN 418


>gi|304392710|ref|ZP_07374650.1| transcription termination factor Rho [Ahrensia sp. R2A130]
 gi|303295340|gb|EFL89700.1| transcription termination factor Rho [Ahrensia sp. R2A130]
          Length = 421

 Score =  692 bits (1787), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/420 (78%), Positives = 380/420 (90%)

Query: 1   MSEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEV 60
           M +MKL +LK K+P  LL+FAE +E+ NA+ +RKQELMF+ILK L+ RDVEIIG+GV+EV
Sbjct: 1   MDQMKLSDLKEKTPKDLLSFAEEMEVVNASTLRKQELMFAILKQLAERDVEIIGQGVVEV 60

Query: 61  LQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVN 120
           LQDGF FLRSP ANYL GPDDIYVSPSQ+K F+L+TGDTVEG IR+P+EGERYFALL VN
Sbjct: 61  LQDGFAFLRSPGANYLPGPDDIYVSPSQLKKFALRTGDTVEGPIRSPQEGERYFALLMVN 120

Query: 121 AINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIV 180
           +INFD PE+V++K+HFDNLTPLYP++R+ ME+++PE KD+S RVIDL+APIGKGQR LIV
Sbjct: 121 SINFDEPEKVKHKVHFDNLTPLYPEERYVMEIDDPEAKDLSGRVIDLVAPIGKGQRGLIV 180

Query: 181 APPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAA 240
           APPRTGKT+LLQN+A SI  NHPE YL+VLLIDERPEEVTDMQRSV+GEVISSTFDE A 
Sbjct: 181 APPRTGKTVLLQNVAKSISANHPESYLLVLLIDERPEEVTDMQRSVKGEVISSTFDEPAT 240

Query: 241 RHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRP 300
           RHVQVAEMVI KAK L E+G DVVILLDSITRL RAYN  +PSSGK+LTGGVDANALQRP
Sbjct: 241 RHVQVAEMVIEKAKRLAEHGRDVVILLDSITRLGRAYNTTVPSSGKVLTGGVDANALQRP 300

Query: 301 KRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPA 360
           KRFFGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RK+ADKR +PA
Sbjct: 301 KRFFGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKVADKRTYPA 360

Query: 361 MDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           MDI+KSGTRKEDLL+E+ DLQK+F+LRRI+SSM ++DAIEFLIDKLKQTK+N +FF SMN
Sbjct: 361 MDILKSGTRKEDLLIEKADLQKIFVLRRILSSMGNTDAIEFLIDKLKQTKNNAEFFDSMN 420


>gi|261755769|ref|ZP_05999478.1| transcription termination factor Rho [Brucella suis bv. 3 str. 686]
 gi|261745522|gb|EEY33448.1| transcription termination factor Rho [Brucella suis bv. 3 str. 686]
          Length = 413

 Score =  690 bits (1780), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/400 (82%), Positives = 369/400 (92%)

Query: 1   MSEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEV 60
           M EMKLQELKNK+P +LLAFAE+LE+ENA+ MRKQELMF+ILK L+ +DVEIIGEGV+EV
Sbjct: 14  MQEMKLQELKNKTPVELLAFAETLEVENASAMRKQELMFAILKKLAAQDVEIIGEGVVEV 73

Query: 61  LQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVN 120
           LQDGFGFLRS DANYL GPDDIY+SPSQ++ FSLKTGDTVEG IR P+EGERYFALLKVN
Sbjct: 74  LQDGFGFLRSADANYLPGPDDIYISPSQLRRFSLKTGDTVEGPIRGPKEGERYFALLKVN 133

Query: 121 AINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIV 180
            INF+ PE++R+K+HFDNLTPLYP++RF MEL  P +KD+S RVIDL+AP+GKGQR LIV
Sbjct: 134 TINFEDPEKIRHKVHFDNLTPLYPNERFKMELEVPTSKDLSPRVIDLVAPLGKGQRGLIV 193

Query: 181 APPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAA 240
           APPRTGKT+LLQNIAHSI  NHPECYLIVLLIDERPEEVTDMQRSV+GEVISSTFDE AA
Sbjct: 194 APPRTGKTVLLQNIAHSITANHPECYLIVLLIDERPEEVTDMQRSVKGEVISSTFDEPAA 253

Query: 241 RHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRP 300
           RHVQVAEMVI KAK LVE+G DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRP
Sbjct: 254 RHVQVAEMVIEKAKRLVEHGRDVVILLDSITRLGRAYNTVVPSSGKVLTGGVDANALQRP 313

Query: 301 KRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPA 360
           KRFFGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RK+ADKRIFPA
Sbjct: 314 KRFFGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKVADKRIFPA 373

Query: 361 MDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIE 400
           MDI+KSGTRKEDLLV R DLQK+F+LRRI++ M ++DAIE
Sbjct: 374 MDILKSGTRKEDLLVPRADLQKIFVLRRILAPMGTTDAIE 413


>gi|90420999|ref|ZP_01228903.1| transcription termination factor Rho [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90334777|gb|EAS48553.1| transcription termination factor Rho [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 419

 Score =  689 bits (1779), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/418 (79%), Positives = 377/418 (90%), Gaps = 1/418 (0%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           MKLQ+LKNKS  +L+AFAE  ++ENA+V+RKQEL+F+ILK L+ ++VEIIGEGV+E+LQD
Sbjct: 1   MKLQDLKNKSAPELIAFAEENDVENASVLRKQELLFAILKQLAAQEVEIIGEGVVEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GF FLRSP+ANYL GPDDIYVSPSQI+ F LKTGDTVEG IR+P+EGERYFALLKVN IN
Sbjct: 61  GFAFLRSPEANYLPGPDDIYVSPSQIRKFQLKTGDTVEGPIRSPKEGERYFALLKVNTIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENK-DISSRVIDLIAPIGKGQRSLIVAP 182
           FD PE++R K HFDNLTPLYPD+RF MEL+ P  K D+S+RVIDL+AP+GKGQR LIVAP
Sbjct: 121 FDNPEKIRYKSHFDNLTPLYPDERFKMELDEPTGKKDMSARVIDLVAPLGKGQRGLIVAP 180

Query: 183 PRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARH 242
           PRTGKT+LLQNIAHSI  NHPECYLIVLLIDERPEEVTDMQRSV+GEV+SSTFDE A RH
Sbjct: 181 PRTGKTVLLQNIAHSITANHPECYLIVLLIDERPEEVTDMQRSVRGEVVSSTFDEPAQRH 240

Query: 243 VQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKR 302
           V VAEMVI KAK LVE+G DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRPKR
Sbjct: 241 VAVAEMVIEKAKRLVEHGRDVVILLDSITRLGRAYNTVVPSSGKVLTGGVDANALQRPKR 300

Query: 303 FFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMD 362
           FFGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RK+ADKRI+PAMD
Sbjct: 301 FFGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKVADKRIYPAMD 360

Query: 363 IIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           I+KSGTRKEDLLV + DLQK+F+LRRI+S M ++DAIEFL DKLKQTK N DFF  MN
Sbjct: 361 ILKSGTRKEDLLVPKGDLQKIFVLRRILSPMGTTDAIEFLNDKLKQTKTNADFFDQMN 418


>gi|254705066|ref|ZP_05166894.1| transcription termination factor Rho [Brucella suis bv. 3 str. 686]
 gi|256253972|ref|ZP_05459508.1| transcription termination factor Rho [Brucella ceti B1/94]
 gi|261221113|ref|ZP_05935394.1| transcription termination factor Rho [Brucella ceti B1/94]
 gi|260919697|gb|EEX86350.1| transcription termination factor Rho [Brucella ceti B1/94]
          Length = 400

 Score =  689 bits (1779), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/400 (82%), Positives = 369/400 (92%)

Query: 1   MSEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEV 60
           M EMKLQELKNK+P +LLAFAE+LE+ENA+ MRKQELMF+ILK L+ +DVEIIGEGV+EV
Sbjct: 1   MQEMKLQELKNKTPVELLAFAETLEVENASAMRKQELMFAILKKLAAQDVEIIGEGVVEV 60

Query: 61  LQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVN 120
           LQDGFGFLRS DANYL GPDDIY+SPSQ++ FSLKTGDTVEG IR P+EGERYFALLKVN
Sbjct: 61  LQDGFGFLRSADANYLPGPDDIYISPSQLRRFSLKTGDTVEGPIRGPKEGERYFALLKVN 120

Query: 121 AINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIV 180
            INF+ PE++R+K+HFDNLTPLYP++RF MEL  P +KD+S RVIDL+AP+GKGQR LIV
Sbjct: 121 TINFEDPEKIRHKVHFDNLTPLYPNERFKMELEVPTSKDLSPRVIDLVAPLGKGQRGLIV 180

Query: 181 APPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAA 240
           APPRTGKT+LLQNIAHSI  NHPECYLIVLLIDERPEEVTDMQRSV+GEVISSTFDE AA
Sbjct: 181 APPRTGKTVLLQNIAHSITANHPECYLIVLLIDERPEEVTDMQRSVKGEVISSTFDEPAA 240

Query: 241 RHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRP 300
           RHVQVAEMVI KAK LVE+G DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRP
Sbjct: 241 RHVQVAEMVIEKAKRLVEHGRDVVILLDSITRLGRAYNTVVPSSGKVLTGGVDANALQRP 300

Query: 301 KRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPA 360
           KRFFGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RK+ADKRIFPA
Sbjct: 301 KRFFGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKVADKRIFPA 360

Query: 361 MDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIE 400
           MDI+KSGTRKEDLLV R DLQK+F+LRRI++ M ++DAIE
Sbjct: 361 MDILKSGTRKEDLLVPRADLQKIFVLRRILAPMGTTDAIE 400


>gi|307943440|ref|ZP_07658784.1| transcription termination factor Rho [Roseibium sp. TrichSKD4]
 gi|307773070|gb|EFO32287.1| transcription termination factor Rho [Roseibium sp. TrichSKD4]
          Length = 418

 Score =  687 bits (1773), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/417 (77%), Positives = 377/417 (90%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           MKL++LK KSPT+LL FAE LE+ENA+ MRKQELMF+ILK L+ +DVEIIGEGV+EVLQD
Sbjct: 1   MKLKDLKEKSPTELLQFAEELEVENASTMRKQELMFAILKNLAAQDVEIIGEGVVEVLQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSPDANYL GPDDIYVSPSQI+ FSL+TGDTVEG IR+P++GERYFALLKVN IN
Sbjct: 61  GFGFLRSPDANYLPGPDDIYVSPSQIRRFSLRTGDTVEGQIRSPKDGERYFALLKVNTIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           F+ P++ R+K+HFDNLTPLYPD+RF ME+ +P  KD+S+RVID++AP+GKGQR LI APP
Sbjct: 121 FEDPDKARHKVHFDNLTPLYPDERFKMEIEDPTRKDMSARVIDMVAPLGKGQRGLITAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           RTGKT+ LQN+A SI  NHPECYLIVLLIDERPEEVTDMQR+V GEV+SSTFDE AARHV
Sbjct: 181 RTGKTVFLQNVAQSITTNHPECYLIVLLIDERPEEVTDMQRTVNGEVVSSTFDEPAARHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+G DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHGRDVVILLDSITRLGRAYNTVVPSSGKVLTGGVDANALQRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEI+L+RKI+DKR++PA+DI
Sbjct: 301 FGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIILDRKISDKRVYPAIDI 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
            +SGTRKE+LLV+ + L+K F+LRRI++ M + DAIEFL+DKL+QTK N DFF SMN
Sbjct: 361 QRSGTRKEELLVDPEKLKKTFVLRRILNPMGTVDAIEFLLDKLRQTKSNDDFFDSMN 417


>gi|118591443|ref|ZP_01548841.1| transcription termination factor Rho [Stappia aggregata IAM 12614]
 gi|118436115|gb|EAV42758.1| transcription termination factor Rho [Stappia aggregata IAM 12614]
          Length = 421

 Score =  687 bits (1772), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/420 (77%), Positives = 377/420 (89%)

Query: 1   MSEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEV 60
           M EMKL++LK K+PT+LL  AE LE+ENA+ MRKQELMF+ILK L+ +DVEIIGEGV+EV
Sbjct: 1   MREMKLKDLKLKTPTELLQTAEELEVENASTMRKQELMFAILKNLAAQDVEIIGEGVVEV 60

Query: 61  LQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVN 120
           LQDGFGFLRSPDANYL GPDDIYVSPSQI+ FSL+TGDTVEG IR+P+EGERYFALLKVN
Sbjct: 61  LQDGFGFLRSPDANYLPGPDDIYVSPSQIRRFSLRTGDTVEGQIRSPKEGERYFALLKVN 120

Query: 121 AINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIV 180
            INF+ P++ R+K+HFDNLTPLYPD+RF ME+ +P  KD+SSRVIDL+AP+GKGQR+LI 
Sbjct: 121 TINFEDPDKARHKVHFDNLTPLYPDERFRMEIEDPTIKDLSSRVIDLVAPLGKGQRALIT 180

Query: 181 APPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAA 240
           APPRTGKT+ LQNIA SI  NHPECYLIVLLIDERPEEVTDMQR+V GEV+SSTFDE AA
Sbjct: 181 APPRTGKTVFLQNIAKSITTNHPECYLIVLLIDERPEEVTDMQRTVDGEVVSSTFDEPAA 240

Query: 241 RHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRP 300
           RHVQVAEMVI KAK L E+G DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRP
Sbjct: 241 RHVQVAEMVIEKAKRLTEHGRDVVILLDSITRLGRAYNTVVPSSGKVLTGGVDANALQRP 300

Query: 301 KRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPA 360
           KRFFGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEI+L+RKI+DKR++PA
Sbjct: 301 KRFFGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIILDRKISDKRVYPA 360

Query: 361 MDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           +DI +SGTRKE+LLV  + L+K F+LRRI++ M + DAIEFL+DKLKQTK N DFF SMN
Sbjct: 361 IDIQRSGTRKEELLVPAERLKKTFVLRRILNPMGTVDAIEFLLDKLKQTKSNDDFFDSMN 420


>gi|254501617|ref|ZP_05113768.1| transcription termination factor Rho [Labrenzia alexandrii DFL-11]
 gi|222437688|gb|EEE44367.1| transcription termination factor Rho [Labrenzia alexandrii DFL-11]
          Length = 421

 Score =  684 bits (1765), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/420 (77%), Positives = 377/420 (89%)

Query: 1   MSEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEV 60
           M EMKL++LK K+PT+LL  AE LE+ENA+ MRKQELMF+ILK L+ +DVEIIGEGV+EV
Sbjct: 1   MREMKLKDLKQKTPTELLQKAEELEVENASTMRKQELMFAILKNLAAQDVEIIGEGVVEV 60

Query: 61  LQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVN 120
           LQDGFGFLRSPDANYL GPDDIYVSPSQI+ FSL+TGDTVEG IR+P+EGERYFALLKVN
Sbjct: 61  LQDGFGFLRSPDANYLPGPDDIYVSPSQIRRFSLRTGDTVEGQIRSPKEGERYFALLKVN 120

Query: 121 AINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIV 180
            INF+ P++ R+K+HFDNLTPLYPD++F ME+ +P  KD+SSRVIDL+AP+GKGQR+LI 
Sbjct: 121 TINFEDPDKARHKVHFDNLTPLYPDEKFKMEIEDPTIKDLSSRVIDLVAPLGKGQRALIT 180

Query: 181 APPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAA 240
           APPRTGKT+ LQNIA SI  NHPECYLIVLLIDERPEEVTDMQR+V GEV+SSTFDE A+
Sbjct: 181 APPRTGKTVFLQNIAKSITNNHPECYLIVLLIDERPEEVTDMQRTVDGEVVSSTFDEPAS 240

Query: 241 RHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRP 300
           RHVQVAEMVI KAK L E+G DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRP
Sbjct: 241 RHVQVAEMVIEKAKRLTEHGRDVVILLDSITRLGRAYNTVVPSSGKVLTGGVDANALQRP 300

Query: 301 KRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPA 360
           KRFFGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEI+L+RKI+DKR++PA
Sbjct: 301 KRFFGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIILDRKISDKRVYPA 360

Query: 361 MDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           +DI +SGTRKE+LLV  + L+K F+LRRI++ M + DA+EFL+DKLKQTK N DFF SMN
Sbjct: 361 IDIQRSGTRKEELLVPPERLKKTFVLRRILNPMGTVDAVEFLLDKLKQTKSNDDFFDSMN 420


>gi|312115408|ref|YP_004013004.1| transcription termination factor Rho [Rhodomicrobium vannielii ATCC
           17100]
 gi|311220537|gb|ADP71905.1| transcription termination factor Rho [Rhodomicrobium vannielii ATCC
           17100]
          Length = 421

 Score =  679 bits (1753), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/420 (76%), Positives = 372/420 (88%)

Query: 1   MSEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEV 60
           M EMKLQ+LK KSPT+LLA AE   +ENA+ +RKQELMF+ILK L+ RD+EI G GV+E 
Sbjct: 1   MQEMKLQDLKVKSPTELLAVAEEFAVENASALRKQELMFAILKQLAARDIEITGIGVVET 60

Query: 61  LQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVN 120
           LQDGFGFLRSPD+NYL GPDDIYVSPSQI+ F L+TGDTVEG IR P++GERYFALLKVN
Sbjct: 61  LQDGFGFLRSPDSNYLPGPDDIYVSPSQIRRFGLRTGDTVEGQIRGPKDGERYFALLKVN 120

Query: 121 AINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIV 180
            INFD PE++R+K+HFDNLTPLYP+    ME + P +KD+S+RVID++AP+GKGQR LIV
Sbjct: 121 KINFDDPEKIRHKVHFDNLTPLYPNDWLKMETDPPHSKDLSARVIDIVAPLGKGQRGLIV 180

Query: 181 APPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAA 240
           APPRTGKT+LLQNIAHSI  NHPECYLIVLLIDERPEEVTDMQRSV+GEVISSTFDE A+
Sbjct: 181 APPRTGKTVLLQNIAHSITANHPECYLIVLLIDERPEEVTDMQRSVRGEVISSTFDEPAS 240

Query: 241 RHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRP 300
           RHVQVAEMVI KAK LVE+ LDVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRP
Sbjct: 241 RHVQVAEMVIEKAKRLVEHKLDVVILLDSITRLGRAYNTVVPSSGKVLTGGVDANALQRP 300

Query: 301 KRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPA 360
           KRFFGAARNI+EGGSLTII TALV+TGSRMDEVIFEEFKGTGNSE+VL+RK+ADKR+FPA
Sbjct: 301 KRFFGAARNIEEGGSLTIIATALVETGSRMDEVIFEEFKGTGNSELVLDRKVADKRVFPA 360

Query: 361 MDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           MDI KSGTRKE+LLV +  L+K+++LRRI++ M   D IEFL+DKL+QTK N DFF SMN
Sbjct: 361 MDIAKSGTRKEELLVPQAQLRKMYVLRRILNPMGPMDGIEFLLDKLRQTKSNGDFFDSMN 420


>gi|182680467|ref|YP_001834613.1| transcription termination factor Rho [Beijerinckia indica subsp.
           indica ATCC 9039]
 gi|182636350|gb|ACB97124.1| transcription termination factor Rho [Beijerinckia indica subsp.
           indica ATCC 9039]
          Length = 422

 Score =  679 bits (1752), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/421 (76%), Positives = 380/421 (90%), Gaps = 1/421 (0%)

Query: 1   MSEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEV 60
           M E+KLQ+LK KSPT+LLAFAE  E+ENA++MRKQELMF+ILK L+ R+VEIIGEGVIEV
Sbjct: 1   MREIKLQDLKLKSPTELLAFAEEHEVENASIMRKQELMFAILKQLASREVEIIGEGVIEV 60

Query: 61  LQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVN 120
           LQDGFGFLRSP+ANYLAGPDDIYVSPSQI+ F L+TGDTVEG IR+P+EGERYFALLKVN
Sbjct: 61  LQDGFGFLRSPEANYLAGPDDIYVSPSQIRRFGLRTGDTVEGLIRSPKEGERYFALLKVN 120

Query: 121 AINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIV 180
            INF+ PE++R+K+HFDNLTPLYPD+R  +E+++P  KD+S+RVID++APIGKGQR+LIV
Sbjct: 121 TINFEDPEKIRHKVHFDNLTPLYPDERLKLEIDDPTKKDLSARVIDIVAPIGKGQRALIV 180

Query: 181 APPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAA 240
           APPRTGKT+LLQNIA S+  NHPECYLIVLLIDERPEEVTDMQRSV+GEVISSTFDE A 
Sbjct: 181 APPRTGKTVLLQNIAQSVTANHPECYLIVLLIDERPEEVTDMQRSVKGEVISSTFDEPAV 240

Query: 241 RHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRP 300
           RHVQVAEMVI KAK LVE+G DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRP
Sbjct: 241 RHVQVAEMVIEKAKRLVEHGRDVVILLDSITRLGRAYNTVVPSSGKVLTGGVDANALQRP 300

Query: 301 KRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPA 360
           KRFFGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEI+L+RK+ADKR+FPA
Sbjct: 301 KRFFGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIILDRKVADKRVFPA 360

Query: 361 MDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQT-KDNKDFFYSM 419
           +DI +SGTRKE+LLV    L+K+++LRRI++ M + D IEFL+ KL++T K N  FF +M
Sbjct: 361 IDITRSGTRKEELLVPTDVLKKMYVLRRILNPMGTVDGIEFLLGKLRETPKGNATFFEAM 420

Query: 420 N 420
           N
Sbjct: 421 N 421


>gi|217978671|ref|YP_002362818.1| transcription termination factor Rho [Methylocella silvestris BL2]
 gi|217504047|gb|ACK51456.1| transcription termination factor Rho [Methylocella silvestris BL2]
          Length = 422

 Score =  675 bits (1742), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/421 (76%), Positives = 378/421 (89%), Gaps = 1/421 (0%)

Query: 1   MSEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEV 60
           M E+KLQ+LK KSPT+LL FAE  E+ENA++MRKQELMF+ILK L+ R++EIIGEGVIEV
Sbjct: 1   MREIKLQDLKLKSPTELLGFAEEHEVENASIMRKQELMFAILKQLASREIEIIGEGVIEV 60

Query: 61  LQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVN 120
           LQDGFGFLRSP+ANYLAGPDDIYVSPSQI+ F L+TGDTVEG IR+P+EGERYFALLKVN
Sbjct: 61  LQDGFGFLRSPEANYLAGPDDIYVSPSQIRRFGLRTGDTVEGLIRSPKEGERYFALLKVN 120

Query: 121 AINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIV 180
            INF+ PE+VR+K+HFDNLTPLYPD+R  +E+ +P  KD+S+RVID++APIGKGQR+LIV
Sbjct: 121 TINFEDPEKVRHKVHFDNLTPLYPDQRLKLEVEDPTRKDLSARVIDIVAPIGKGQRALIV 180

Query: 181 APPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAA 240
           APPRTGKT+LLQNIA S+  NHPECYLIVLLIDERPEEVTDMQRSV GEV+SSTFDE A 
Sbjct: 181 APPRTGKTVLLQNIAQSVTANHPECYLIVLLIDERPEEVTDMQRSVHGEVVSSTFDEPAV 240

Query: 241 RHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRP 300
           RHVQVAEMVI KAK LVE+G DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRP
Sbjct: 241 RHVQVAEMVIEKAKRLVEHGRDVVILLDSITRLGRAYNTVVPSSGKVLTGGVDANALQRP 300

Query: 301 KRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPA 360
           KRFFGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEI+L+RK+ADKR+FP+
Sbjct: 301 KRFFGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIILDRKVADKRVFPS 360

Query: 361 MDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQT-KDNKDFFYSM 419
           +DI +SGTRKE+LLV    L+K+++LRRI++ M + DAIEFL+ KL++T K N  FF +M
Sbjct: 361 IDITRSGTRKEELLVPPDILKKMYVLRRILNPMGTIDAIEFLLGKLRETPKGNSTFFEAM 420

Query: 420 N 420
           N
Sbjct: 421 N 421


>gi|114571509|ref|YP_758189.1| transcription termination factor Rho [Maricaulis maris MCS10]
 gi|114341971|gb|ABI67251.1| transcription termination factor Rho [Maricaulis maris MCS10]
          Length = 436

 Score =  674 bits (1739), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/420 (75%), Positives = 375/420 (89%)

Query: 1   MSEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEV 60
           +  M LQ+LK K PT+L+ FAE+LEIENA+ +RKQ +MF+ILK L+ RDVEI G GV+EV
Sbjct: 16  LERMTLQDLKEKKPTELVEFAEALEIENASSLRKQAMMFAILKSLAERDVEIHGGGVMEV 75

Query: 61  LQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVN 120
           LQDGFGFLRSP++NYLAGPDDIYVSP+QI+ F L+TGDTVEG IR+PR+GERYFALLKV+
Sbjct: 76  LQDGFGFLRSPESNYLAGPDDIYVSPTQIRKFGLRTGDTVEGEIRSPRDGERYFALLKVS 135

Query: 121 AINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIV 180
            INF  PE  R+K+HFDNLTPLYP+ RFNMEL +P  KD S RVID+++P+GKGQR LIV
Sbjct: 136 TINFQDPESARHKVHFDNLTPLYPESRFNMELADPTVKDRSGRVIDIVSPLGKGQRGLIV 195

Query: 181 APPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAA 240
           APPRTGKT+LLQNIAH+I+ NHP+CYL+VLLIDERPEEVTDMQR+V+GEVISSTFDE A 
Sbjct: 196 APPRTGKTVLLQNIAHAIESNHPDCYLMVLLIDERPEEVTDMQRTVKGEVISSTFDEPAT 255

Query: 241 RHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRP 300
           RHVQVAEMVI KAK LVE+G DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRP
Sbjct: 256 RHVQVAEMVIEKAKRLVEHGRDVVILLDSITRLGRAYNTVVPSSGKVLTGGVDANALQRP 315

Query: 301 KRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPA 360
           KRFFGAARNI+ GGSLTII TAL+DTGSRMDEVIFEEFKGTGNSE+VL+RK+ADKR+FPA
Sbjct: 316 KRFFGAARNIEHGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEVVLDRKVADKRVFPA 375

Query: 361 MDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           +DI+KSGTRKE+LLV+R  LQK+++LRRI++ M + DAIEFL+DKL+QTK N +FF SMN
Sbjct: 376 IDILKSGTRKEELLVDRGQLQKMYVLRRILNPMGAQDAIEFLLDKLRQTKTNDEFFDSMN 435


>gi|154251713|ref|YP_001412537.1| transcription termination factor Rho [Parvibaculum lavamentivorans
           DS-1]
 gi|154155663|gb|ABS62880.1| transcription termination factor Rho [Parvibaculum lavamentivorans
           DS-1]
          Length = 422

 Score =  674 bits (1738), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/419 (75%), Positives = 378/419 (90%)

Query: 2   SEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVL 61
           +++KLQ+LK KSPT+LLA AE LE+ENA+ +R Q++MF+ILK  + ++++IIGEGV+EVL
Sbjct: 3   TQIKLQDLKAKSPTELLAIAEELEVENASTLRTQDMMFAILKQYAEQNIDIIGEGVVEVL 62

Query: 62  QDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNA 121
            DGFGFLRSP+ANYL GPDDIYVSPSQI+ FSL+TGDTVEG IR+P++GERYFALLKV+ 
Sbjct: 63  PDGFGFLRSPEANYLPGPDDIYVSPSQIRRFSLRTGDTVEGEIRSPKDGERYFALLKVST 122

Query: 122 INFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVA 181
           +NF+ P++ R+K+HFDNLTPLYPD++  ME+ +P  KD SSR+ID++AP+GKGQR LIVA
Sbjct: 123 VNFESPDKARHKVHFDNLTPLYPDEKLEMEVADPTLKDRSSRLIDIVAPLGKGQRGLIVA 182

Query: 182 PPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAAR 241
           PPRTGKT+LLQNIAHSI  NHPECYLIVLLIDERPEEVTDMQRSV+GEVISSTFDE A R
Sbjct: 183 PPRTGKTVLLQNIAHSITTNHPECYLIVLLIDERPEEVTDMQRSVKGEVISSTFDEPATR 242

Query: 242 HVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPK 301
           HVQVAEMVI KAK LVE+G DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRPK
Sbjct: 243 HVQVAEMVIEKAKRLVEHGRDVVILLDSITRLGRAYNTVVPSSGKVLTGGVDANALQRPK 302

Query: 302 RFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAM 361
           RFFGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RKIADKR+FPAM
Sbjct: 303 RFFGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKIADKRVFPAM 362

Query: 362 DIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           DI+KSGTRKE+LLV++  L K+++LRRI++ M + DA+EFL+DKLKQTK N +FF SMN
Sbjct: 363 DILKSGTRKEELLVDKGTLSKMYVLRRILNPMGTVDAVEFLLDKLKQTKSNGEFFDSMN 421


>gi|170750678|ref|YP_001756938.1| transcription termination factor Rho [Methylobacterium
           radiotolerans JCM 2831]
 gi|170657200|gb|ACB26255.1| transcription termination factor Rho [Methylobacterium
           radiotolerans JCM 2831]
          Length = 428

 Score =  672 bits (1733), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/418 (75%), Positives = 373/418 (89%)

Query: 3   EMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQ 62
           E+KLQ+LK+K+PT L AFAE +E+ENA+ MRKQELMF+ILK L+ ++VEIIG G +EVLQ
Sbjct: 10  EVKLQDLKSKTPTDLTAFAEEVEVENASTMRKQELMFAILKQLAAKEVEIIGSGTVEVLQ 69

Query: 63  DGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAI 122
           DGFGFLRS D+NYL GPDDIY+SP+QI+ F L+TGDTVEG IR P++GERYFALLKVN I
Sbjct: 70  DGFGFLRSSDSNYLPGPDDIYISPTQIRRFGLRTGDTVEGPIRGPKDGERYFALLKVNTI 129

Query: 123 NFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAP 182
           NF+ PE++++K+HFDNLTPL+P KRF +EL+NP  KD S R+ID++APIGKGQR+LIVAP
Sbjct: 130 NFENPEKIKHKVHFDNLTPLFPTKRFKLELDNPTKKDFSPRIIDIVAPIGKGQRALIVAP 189

Query: 183 PRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARH 242
           PRTGKT+L+QNIA SI  NHPECYLIVLLIDERPEEVTDMQRSV+GEVI+STFDE A RH
Sbjct: 190 PRTGKTVLMQNIAQSITLNHPECYLIVLLIDERPEEVTDMQRSVKGEVIASTFDEPATRH 249

Query: 243 VQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKR 302
           VQVAEMVI KAK LVE+G DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRPKR
Sbjct: 250 VQVAEMVIEKAKRLVEHGRDVVILLDSITRLGRAYNTVVPSSGKVLTGGVDANALQRPKR 309

Query: 303 FFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMD 362
           FFGAARNI+EGGSL+II TAL+DTGSRMDEVIFEEFKGTGNSEI+L+RK++DKRIFPA+D
Sbjct: 310 FFGAARNIEEGGSLSIIATALIDTGSRMDEVIFEEFKGTGNSEIILDRKVSDKRIFPAID 369

Query: 363 IIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           I +SGTRKE+LLV    L+K ++LRRI++ M  +DAIEFL+DKL+QTK N DFF SMN
Sbjct: 370 ITRSGTRKEELLVPPDSLKKTYVLRRILNPMGVTDAIEFLLDKLRQTKSNSDFFDSMN 427


>gi|170739672|ref|YP_001768327.1| transcription termination factor Rho [Methylobacterium sp. 4-46]
 gi|168193946|gb|ACA15893.1| transcription termination factor Rho [Methylobacterium sp. 4-46]
          Length = 436

 Score =  672 bits (1733), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/420 (75%), Positives = 375/420 (89%)

Query: 1   MSEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEV 60
           M E+KLQ+LK+K+PT+L+AFAE +E+ENA+ MRKQELMF+ILK L+ +DVEIIG G +EV
Sbjct: 16  MREVKLQDLKSKTPTELIAFAEEVEVENASTMRKQELMFAILKQLAAKDVEIIGAGTVEV 75

Query: 61  LQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVN 120
           LQDGFGFLRS D+NYL GPDDIYVSP+QI+ F L+TGDTVEG IR P++GERYFALLKVN
Sbjct: 76  LQDGFGFLRSSDSNYLPGPDDIYVSPTQIRRFGLRTGDTVEGPIRGPKDGERYFALLKVN 135

Query: 121 AINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIV 180
            INF+ P+++++K+HFDNLTPL+P +RF +EL+ P  KD S RVID+++PIGKGQR+LIV
Sbjct: 136 TINFENPDKIKHKVHFDNLTPLFPTQRFKLELSEPTRKDFSPRVIDIVSPIGKGQRALIV 195

Query: 181 APPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAA 240
           APPRTGKT+L+QNIA SI  NHPECYLIVLLIDERPEEVTDMQRSV+GEVI+STFDE A 
Sbjct: 196 APPRTGKTVLMQNIAQSITINHPECYLIVLLIDERPEEVTDMQRSVKGEVIASTFDEPAT 255

Query: 241 RHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRP 300
           RHVQVAEMVI KAK LVE+G DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRP
Sbjct: 256 RHVQVAEMVIEKAKRLVEHGRDVVILLDSITRLGRAYNTVVPSSGKVLTGGVDANALQRP 315

Query: 301 KRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPA 360
           KRFFGAARNI+EGGSL+II TAL+DTGSRMDEVIFEEFKGTGNSEI+L+RK+ADKR FPA
Sbjct: 316 KRFFGAARNIEEGGSLSIIATALIDTGSRMDEVIFEEFKGTGNSEIILDRKVADKRTFPA 375

Query: 361 MDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           +DI +SGTRKE+LLV    L+K ++LRRI++ M  +DAIEFL+DKL+QTK N+DFF SMN
Sbjct: 376 IDITRSGTRKEELLVPPDTLKKTYVLRRILNPMGVTDAIEFLLDKLRQTKSNQDFFDSMN 435


>gi|209883536|ref|YP_002287393.1| transcription termination factor Rho [Oligotropha carboxidovorans
           OM5]
 gi|209871732|gb|ACI91528.1| transcription termination factor Rho [Oligotropha carboxidovorans
           OM5]
          Length = 421

 Score =  671 bits (1732), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/420 (74%), Positives = 379/420 (90%)

Query: 1   MSEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEV 60
           M EMKLQ+LK K+P +L++FAE L +ENA+ MRKQELMF+ILK+L+ ++ +IIGEGV+E+
Sbjct: 1   MREMKLQDLKAKTPAELVSFAEELGVENASTMRKQELMFAILKLLASQETDIIGEGVVEI 60

Query: 61  LQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVN 120
           L DGFGFLRS DANYL GPDDIYVSPSQI+ F L+TGDT+EG IR+P+EGERYFALLKVN
Sbjct: 61  LPDGFGFLRSSDANYLPGPDDIYVSPSQIRRFGLRTGDTIEGQIRSPKEGERYFALLKVN 120

Query: 121 AINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIV 180
            +NF+ PE+ ++K++FDNLTPL+PD+RF +ELN+P  KD+S RVID++APIGKGQR+LIV
Sbjct: 121 TLNFEDPEKSKHKVNFDNLTPLFPDERFKLELNDPTRKDLSPRVIDIVAPIGKGQRALIV 180

Query: 181 APPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAA 240
           APPRTGKT+L+QNIAH+I  NHPECYLIVLLIDERPEEVTDMQRSV+GEV+SSTFDE A 
Sbjct: 181 APPRTGKTVLMQNIAHAITTNHPECYLIVLLIDERPEEVTDMQRSVKGEVVSSTFDEPAV 240

Query: 241 RHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRP 300
           RHVQVAEMVI KAK LVE+G DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRP
Sbjct: 241 RHVQVAEMVIEKAKRLVEHGRDVVILLDSITRLGRAYNTVVPSSGKVLTGGVDANALQRP 300

Query: 301 KRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPA 360
           KRFFGAARNI+EGGSLTII TALVDTGSRMDEVIFEEFKGTGNSE++L+RK++DKRIFPA
Sbjct: 301 KRFFGAARNIEEGGSLTIIATALVDTGSRMDEVIFEEFKGTGNSELILDRKVSDKRIFPA 360

Query: 361 MDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           +DI +SGTRKE+L+ + Q L+K+++LRRI++ M + DAIEFL+DKL+ TK+N +FF SMN
Sbjct: 361 IDIARSGTRKEELITDPQTLKKMYVLRRILNPMGTMDAIEFLLDKLRSTKNNAEFFDSMN 420


>gi|254295493|ref|YP_003061516.1| transcription termination factor Rho [Hirschia baltica ATCC 49814]
 gi|254044024|gb|ACT60819.1| transcription termination factor Rho [Hirschia baltica ATCC 49814]
          Length = 427

 Score =  671 bits (1731), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/416 (76%), Positives = 373/416 (89%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK KSPT LLAFAE+LE+ENA+ +R QEL+F+ILK LS RDVEI+G GV+EVL D
Sbjct: 10  MTLAELKLKSPTDLLAFAENLEVENASSLRTQELLFAILKELSERDVEIVGGGVVEVLSD 69

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSP +NYL GPDDIYVSP QI+   L+TGDTVEG IR PR  ERYFAL+KV +IN
Sbjct: 70  GFGFLRSPQSNYLPGPDDIYVSPQQIRRMGLRTGDTVEGEIRGPRNDERYFALVKVESIN 129

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           F+ P++V++K+HFDNLTPLYP++RFN+E+ +P  KD S RVID++APIGKGQR+LIVAPP
Sbjct: 130 FEAPDQVKHKVHFDNLTPLYPEERFNIEIPDPTRKDKSGRVIDIVAPIGKGQRALIVAPP 189

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           RTGKT+LLQNIA SI +NHPECYL+VLLIDERPEEVTDMQRSV+GEVISSTFDE A RHV
Sbjct: 190 RTGKTVLLQNIAQSIAENHPECYLLVLLIDERPEEVTDMQRSVKGEVISSTFDEPATRHV 249

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK L E+G DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRPKRF
Sbjct: 250 QVAEMVIEKAKRLAEHGRDVVILLDSITRLGRAYNTVVPSSGKVLTGGVDANALQRPKRF 309

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEIVLERKIADKR+FPA+DI
Sbjct: 310 FGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRVFPAIDI 369

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSM 419
           +KSGTRKE+LL++++DLQKV++LRRI++ M + DAIEFL+DKLKQTK+N +FF SM
Sbjct: 370 LKSGTRKEELLMQQKDLQKVYILRRILNPMGAQDAIEFLLDKLKQTKNNDEFFDSM 425


>gi|75674299|ref|YP_316720.1| transcription termination factor Rho [Nitrobacter winogradskyi
           Nb-255]
 gi|74419169|gb|ABA03368.1| transcription termination factor Rho [Nitrobacter winogradskyi
           Nb-255]
          Length = 421

 Score =  671 bits (1731), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/420 (75%), Positives = 378/420 (90%)

Query: 1   MSEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEV 60
           M EMKLQ+LK K+P +L++FAE L +ENA+ MRKQELMF+ILK L+ ++ +IIGEGV+EV
Sbjct: 1   MREMKLQDLKAKTPAELVSFAEELGVENASTMRKQELMFAILKQLAIQETDIIGEGVVEV 60

Query: 61  LQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVN 120
           L DGFGFLRSPDANYL GPDDIYVSPSQI+ F L+TGDT+EG IR+P+EGERYFALLKVN
Sbjct: 61  LSDGFGFLRSPDANYLPGPDDIYVSPSQIRRFGLRTGDTIEGHIRSPKEGERYFALLKVN 120

Query: 121 AINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIV 180
            +NF+ PE+ ++K++FDNLTPL+PD+RF +EL +P  KD+S+RVID++APIGKGQR+LIV
Sbjct: 121 TLNFEDPEKSKHKVNFDNLTPLFPDQRFRLELEDPTRKDLSARVIDIVAPIGKGQRALIV 180

Query: 181 APPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAA 240
           APPRTGKT+L+QNIAHSI  NHPECYLIVLLIDERPEEVTDMQRSV+GEV+SSTFDE A 
Sbjct: 181 APPRTGKTVLMQNIAHSITANHPECYLIVLLIDERPEEVTDMQRSVKGEVVSSTFDEPAV 240

Query: 241 RHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRP 300
           RHVQVAEMVI KAK LVE+G DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRP
Sbjct: 241 RHVQVAEMVIEKAKRLVEHGRDVVILLDSITRLGRAYNTVVPSSGKVLTGGVDANALQRP 300

Query: 301 KRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPA 360
           KRFFGAARNI+EGGSLTII TALVDTGSRMDEVIFEEFKGTGNSE++L+RK+ADKR FPA
Sbjct: 301 KRFFGAARNIEEGGSLTIIATALVDTGSRMDEVIFEEFKGTGNSELILDRKVADKRTFPA 360

Query: 361 MDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           +DI +SGTRKE+L+ + Q L+K+++LRRI++ M + DAIEFL+DKL+ TK+N +FF SMN
Sbjct: 361 IDIARSGTRKEELITDPQLLKKMYVLRRILNPMGTMDAIEFLLDKLRNTKNNSEFFESMN 420


>gi|85714092|ref|ZP_01045081.1| transcription termination factor Rho [Nitrobacter sp. Nb-311A]
 gi|85699218|gb|EAQ37086.1| transcription termination factor Rho [Nitrobacter sp. Nb-311A]
          Length = 421

 Score =  671 bits (1730), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/420 (75%), Positives = 378/420 (90%)

Query: 1   MSEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEV 60
           M EMKLQ+LK K+P +L++FAE L +ENA+ MRKQELMF+ILK L+ ++ +IIGEGV+EV
Sbjct: 1   MREMKLQDLKAKTPAELVSFAEELGVENASTMRKQELMFAILKQLAIQETDIIGEGVVEV 60

Query: 61  LQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVN 120
           L DGFGFLRSPDANYL GPDDIYVSPSQI+ F L+TGDT+EG IR+P+EGERYFALLKVN
Sbjct: 61  LSDGFGFLRSPDANYLPGPDDIYVSPSQIRRFGLRTGDTIEGHIRSPKEGERYFALLKVN 120

Query: 121 AINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIV 180
            +NF+ PE+ ++K++FDNLTPL+PD+RF +EL +P  KD+S+RVID++APIGKGQR+LIV
Sbjct: 121 TLNFEDPEKSKHKVNFDNLTPLFPDQRFRLELEDPTRKDLSARVIDIVAPIGKGQRALIV 180

Query: 181 APPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAA 240
           APPRTGKT+L+QNIAHSI  NHPECYLIVLLIDERPEEVTDMQRSV+GEV+SSTFDE A 
Sbjct: 181 APPRTGKTVLMQNIAHSITANHPECYLIVLLIDERPEEVTDMQRSVKGEVVSSTFDEPAV 240

Query: 241 RHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRP 300
           RHVQVAEMVI KAK LVE+G DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRP
Sbjct: 241 RHVQVAEMVIEKAKRLVEHGRDVVILLDSITRLGRAYNTVVPSSGKVLTGGVDANALQRP 300

Query: 301 KRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPA 360
           KRFFGAARNI+EGGSLTII TALVDTGSRMDEVIFEEFKGTGNSE++L+RK+ADKR FPA
Sbjct: 301 KRFFGAARNIEEGGSLTIIATALVDTGSRMDEVIFEEFKGTGNSELILDRKVADKRTFPA 360

Query: 361 MDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           +DI +SGTRKE+L+ + Q L+K+++LRRI++ M + DAIEFL+DKL+ TK+N +FF SMN
Sbjct: 361 IDIARSGTRKEELITDPQLLKKMYVLRRILNPMGTMDAIEFLLDKLRNTKNNGEFFESMN 420


>gi|298293759|ref|YP_003695698.1| transcription termination factor Rho [Starkeya novella DSM 506]
 gi|296930270|gb|ADH91079.1| transcription termination factor Rho [Starkeya novella DSM 506]
          Length = 421

 Score =  671 bits (1730), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/420 (75%), Positives = 375/420 (89%)

Query: 1   MSEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEV 60
           M EMKLQ+LK+K+P +LL FAE LE+ENA+ +RKQELMF+ILK L+ R+ +IIGEGV+E+
Sbjct: 1   MGEMKLQDLKSKNPAELLVFAEELEVENASTLRKQELMFAILKQLAARETDIIGEGVVEI 60

Query: 61  LQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVN 120
           L DGFGFLRSPDANYL GPDDIYVSPSQI+ F L+TGDTVEG IR+P++GERYFALLKVN
Sbjct: 61  LSDGFGFLRSPDANYLPGPDDIYVSPSQIRRFGLRTGDTVEGQIRSPKDGERYFALLKVN 120

Query: 121 AINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIV 180
            INF+ P+++R+KI+FDNLTPLYPD+R  +E+ +P  KD S+RVID++APIGKGQR LIV
Sbjct: 121 TINFEDPDKIRHKINFDNLTPLYPDERLKLEIEDPTRKDFSARVIDIVAPIGKGQRGLIV 180

Query: 181 APPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAA 240
           APPRTGKT+LLQNIA SI  NHPECYLIVLLIDERPEEVTDMQRSV+GEV+SSTFDE A 
Sbjct: 181 APPRTGKTVLLQNIAQSITTNHPECYLIVLLIDERPEEVTDMQRSVKGEVVSSTFDEPAQ 240

Query: 241 RHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRP 300
           RHVQVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRP
Sbjct: 241 RHVQVAEMVIEKAKRLVEHKRDVVILLDSITRLGRAYNTVVPSSGKVLTGGVDANALQRP 300

Query: 301 KRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPA 360
           KRFFGAARNI+EGGSLTII TAL++TGSRMDEVIFEEFKGTGNSE++L+RK++DKR+FPA
Sbjct: 301 KRFFGAARNIEEGGSLTIIATALIETGSRMDEVIFEEFKGTGNSEVILDRKVSDKRVFPA 360

Query: 361 MDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           +DI +SGTRKE+LLV    L+K+++LRRI++ M + DAIEFL+DKL+QTK N DFF SMN
Sbjct: 361 IDITRSGTRKEELLVPADVLKKMYVLRRILNPMGTVDAIEFLVDKLRQTKTNGDFFDSMN 420


>gi|220921012|ref|YP_002496313.1| transcription termination factor Rho [Methylobacterium nodulans ORS
           2060]
 gi|219945618|gb|ACL56010.1| transcription termination factor Rho [Methylobacterium nodulans ORS
           2060]
          Length = 436

 Score =  670 bits (1729), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/420 (75%), Positives = 374/420 (89%)

Query: 1   MSEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEV 60
           M E+KLQ+LK+K+PT+L+AFAE +E+ENA+ MRKQELMF+ILK L+ +DVEIIG G +EV
Sbjct: 16  MREVKLQDLKSKTPTELIAFAEEVEVENASTMRKQELMFAILKQLAAKDVEIIGAGTVEV 75

Query: 61  LQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVN 120
           LQDGFGFLRS D+NYL GPDDIYVSP+QI+ F L+TGDTV+G IR P++GERYFALLKVN
Sbjct: 76  LQDGFGFLRSSDSNYLPGPDDIYVSPTQIRRFGLRTGDTVDGPIRGPKDGERYFALLKVN 135

Query: 121 AINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIV 180
            INF+ P+++++K+HFDNLTPL+P +RF +EL+ P  KD S RVID+++PIGKGQR+LIV
Sbjct: 136 TINFENPDKIKHKVHFDNLTPLFPTQRFKLELSEPTRKDYSPRVIDIVSPIGKGQRALIV 195

Query: 181 APPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAA 240
           APPRTGKT+L+QNIA SI  NHPECYLIVLLIDERPEEVTDMQRSV+GEVI+STFDE A 
Sbjct: 196 APPRTGKTVLMQNIAQSITINHPECYLIVLLIDERPEEVTDMQRSVKGEVIASTFDEPAT 255

Query: 241 RHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRP 300
           RHVQVAEMVI KAK LVE+G DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRP
Sbjct: 256 RHVQVAEMVIEKAKRLVEHGRDVVILLDSITRLGRAYNTVVPSSGKVLTGGVDANALQRP 315

Query: 301 KRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPA 360
           KRFFGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEI+L+RK+ADKR FPA
Sbjct: 316 KRFFGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIILDRKVADKRTFPA 375

Query: 361 MDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           +DI +SGTRKE+LLV    L+K ++LRRI++ M  +DAIEFL+DKL+QTK N DFF SMN
Sbjct: 376 IDITRSGTRKEELLVPPDTLKKTYVLRRILNPMGVTDAIEFLLDKLRQTKSNADFFDSMN 435


>gi|316931723|ref|YP_004106705.1| transcription termination factor Rho [Rhodopseudomonas palustris
           DX-1]
 gi|315599437|gb|ADU41972.1| transcription termination factor Rho [Rhodopseudomonas palustris
           DX-1]
          Length = 421

 Score =  670 bits (1728), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/420 (74%), Positives = 379/420 (90%)

Query: 1   MSEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEV 60
           M E+KLQ+LK K+P +L++FAE L +ENA+ MRKQELMF+ LK LS ++ +IIGEGV+EV
Sbjct: 1   MREIKLQDLKAKTPAELVSFAEELGVENASTMRKQELMFACLKQLSAKETDIIGEGVVEV 60

Query: 61  LQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVN 120
           L DGFGFLRSPDANYL GPDDIYVSPSQI+ F L+TGDT+EG IR+P+EGERYFALLKVN
Sbjct: 61  LSDGFGFLRSPDANYLPGPDDIYVSPSQIRRFGLRTGDTIEGHIRSPKEGERYFALLKVN 120

Query: 121 AINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIV 180
           ++NF+ PE+ ++K++FDNLTPL+PD+RF +E+++P  KD+S+RVID++APIGKGQR+LIV
Sbjct: 121 SLNFEDPEKSKHKVNFDNLTPLFPDERFRLEIDDPTRKDLSARVIDIVAPIGKGQRALIV 180

Query: 181 APPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAA 240
           APPRTGKT+L+QNIAHSI  NHPECYLIVLLIDERPEEVTDMQRSV+GEVISSTFDE A 
Sbjct: 181 APPRTGKTVLMQNIAHSITANHPECYLIVLLIDERPEEVTDMQRSVKGEVISSTFDEPAV 240

Query: 241 RHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRP 300
           RHVQVAEMVI KAK LVE+G DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRP
Sbjct: 241 RHVQVAEMVIEKAKRLVEHGRDVVILLDSITRLGRAYNTVVPSSGKVLTGGVDANALQRP 300

Query: 301 KRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPA 360
           KRFFGAARNI+EGGSLTII TALVDTGSRMDEVIFEEFKGTGNSE++L+RK+ADKR FPA
Sbjct: 301 KRFFGAARNIEEGGSLTIIATALVDTGSRMDEVIFEEFKGTGNSELILDRKVADKRTFPA 360

Query: 361 MDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           +DI +SGTRKE+L+ + Q L+K+++LRRI++ M + DAIEFL+DKL+ TK+N +FF SMN
Sbjct: 361 IDISRSGTRKEELITDPQLLKKMYVLRRILNPMGTMDAIEFLLDKLRNTKNNSEFFDSMN 420


>gi|146337364|ref|YP_001202412.1| transcription termination factor Rho [Bradyrhizobium sp. ORS278]
 gi|148251781|ref|YP_001236366.1| transcription termination factor Rho [Bradyrhizobium sp. BTAi1]
 gi|146190170|emb|CAL74162.1| Transcription termination factor Rho [Bradyrhizobium sp. ORS278]
 gi|146403954|gb|ABQ32460.1| transcription termination factor Rho [Bradyrhizobium sp. BTAi1]
          Length = 421

 Score =  669 bits (1726), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/420 (74%), Positives = 378/420 (90%)

Query: 1   MSEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEV 60
           M E+KLQ+LK+K+P +L++FAE   +ENA+ MRKQELMF+ILK L+ ++ +IIGEGV+EV
Sbjct: 1   MREIKLQDLKSKTPAELVSFAEENGVENASTMRKQELMFAILKQLAIQETDIIGEGVVEV 60

Query: 61  LQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVN 120
           L DGFGFLRSPDANYL GPDDIYVSPSQI+ F L+TGDT+EG IR+P+EGERYFALLKVN
Sbjct: 61  LSDGFGFLRSPDANYLPGPDDIYVSPSQIRRFGLRTGDTIEGHIRSPKEGERYFALLKVN 120

Query: 121 AINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIV 180
            +NF+ PE+ ++K++FDNLTPL+PD+RF +EL +P  KD+S RVID++APIGKGQR+LIV
Sbjct: 121 TLNFEDPEKSKHKVNFDNLTPLFPDERFRLELEDPTRKDLSPRVIDIVAPIGKGQRALIV 180

Query: 181 APPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAA 240
           APPRTGKT+L+QNIAHSI  NHPECYLIVLLIDERPEEVTDMQRSV+GEV+SSTFDE AA
Sbjct: 181 APPRTGKTVLMQNIAHSITANHPECYLIVLLIDERPEEVTDMQRSVKGEVVSSTFDEPAA 240

Query: 241 RHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRP 300
           RHVQVAEMVI KAK LVE+G DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRP
Sbjct: 241 RHVQVAEMVIEKAKRLVEHGRDVVILLDSITRLGRAYNTVVPSSGKVLTGGVDANALQRP 300

Query: 301 KRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPA 360
           KRFFGAARNI+EGGSLTII TALVDTGSRMDEVIFEEFKGTGNSE++L+RK+ADKR FPA
Sbjct: 301 KRFFGAARNIEEGGSLTIIATALVDTGSRMDEVIFEEFKGTGNSELILDRKVADKRTFPA 360

Query: 361 MDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           +DI +SGTRKE+L+ E Q+L+K+++LRRI++ M + DAI+FL+DKL+ TK N +FF SMN
Sbjct: 361 IDIARSGTRKEELITEPQNLKKMYVLRRILNPMGTMDAIDFLLDKLRSTKSNAEFFESMN 420


>gi|115522410|ref|YP_779321.1| transcription termination factor Rho [Rhodopseudomonas palustris
           BisA53]
 gi|115516357|gb|ABJ04341.1| transcription termination factor Rho [Rhodopseudomonas palustris
           BisA53]
          Length = 421

 Score =  669 bits (1726), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/420 (74%), Positives = 377/420 (89%)

Query: 1   MSEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEV 60
           M EMKLQ+LK K+P +L++FAE L +ENA+ MRKQELMF+ LK LS ++ +IIGEGV+EV
Sbjct: 1   MREMKLQDLKAKTPAELVSFAEELGVENASTMRKQELMFACLKQLSAKETDIIGEGVVEV 60

Query: 61  LQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVN 120
           L DGFGFLRSPDANYL GPDDIYVSPSQI+ F L+TGDT+EG IR+P+EGERYFALLKVN
Sbjct: 61  LSDGFGFLRSPDANYLPGPDDIYVSPSQIRRFGLRTGDTIEGHIRSPKEGERYFALLKVN 120

Query: 121 AINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIV 180
            +NF+ PE+ ++K++FDNLTPL+PD+RF +EL +P  KD+S+RVID++APIGKGQR+LIV
Sbjct: 121 TLNFEDPEKSKHKVNFDNLTPLFPDERFRLELEDPTRKDLSARVIDIVAPIGKGQRALIV 180

Query: 181 APPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAA 240
           APPRTGKT+L+QNIAHSI  NHPECYLIVLLIDERPEEVTDMQRSV+GEV+SSTFDE A 
Sbjct: 181 APPRTGKTVLMQNIAHSITANHPECYLIVLLIDERPEEVTDMQRSVKGEVVSSTFDEPAV 240

Query: 241 RHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRP 300
           RHVQVAEMVI KAK LVE+G DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRP
Sbjct: 241 RHVQVAEMVIEKAKRLVEHGRDVVILLDSITRLGRAYNTVVPSSGKVLTGGVDANALQRP 300

Query: 301 KRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPA 360
           KRFFGAARNI+EGGSLTII TALVDTGSRMDEVIFEEFKGTGNSE++L+RK++DKR FPA
Sbjct: 301 KRFFGAARNIEEGGSLTIIATALVDTGSRMDEVIFEEFKGTGNSELILDRKVSDKRTFPA 360

Query: 361 MDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           +DI +SGTRKE+L+ + Q L+K+++LRRI++ M + DAI+FL+DKL+ TK+N +FF SMN
Sbjct: 361 IDISRSGTRKEELITDPQLLKKMYVLRRILNPMGTMDAIDFLLDKLRNTKNNSEFFESMN 420


>gi|91974908|ref|YP_567567.1| transcription termination factor Rho [Rhodopseudomonas palustris
           BisB5]
 gi|91681364|gb|ABE37666.1| transcription termination factor Rho [Rhodopseudomonas palustris
           BisB5]
          Length = 421

 Score =  669 bits (1726), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/420 (74%), Positives = 378/420 (90%)

Query: 1   MSEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEV 60
           M EMKLQ+LK K+P +L++FAE L +ENA+ MRKQELMF+ LK LS ++ +IIGEGV+EV
Sbjct: 1   MREMKLQDLKAKTPAELVSFAEELGVENASTMRKQELMFACLKQLSAKETDIIGEGVVEV 60

Query: 61  LQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVN 120
           L DGFGFLRSPDANYL GPDDIYVSPSQI+ F L+TGDT+EG IR+P+EGERYFALLKVN
Sbjct: 61  LSDGFGFLRSPDANYLPGPDDIYVSPSQIRRFGLRTGDTIEGHIRSPKEGERYFALLKVN 120

Query: 121 AINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIV 180
            +NF+ PE+ ++K++FDNLTPL+PD+RF +E+++P  KD+S+RVID++APIGKGQR+LIV
Sbjct: 121 TLNFEDPEKSKHKVNFDNLTPLFPDERFRLEIDDPTRKDLSARVIDIVAPIGKGQRALIV 180

Query: 181 APPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAA 240
           APPRTGKT+L+QNIAHSI  NHPECYLIVLLIDERPEEVTDMQRSV+GEV+SSTFDE A 
Sbjct: 181 APPRTGKTVLMQNIAHSITANHPECYLIVLLIDERPEEVTDMQRSVKGEVVSSTFDEPAV 240

Query: 241 RHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRP 300
           RHVQVAEMVI KAK LVE+G DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRP
Sbjct: 241 RHVQVAEMVIEKAKRLVEHGRDVVILLDSITRLGRAYNTVVPSSGKVLTGGVDANALQRP 300

Query: 301 KRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPA 360
           KRFFGAARNI+EGGSLTII TALVDTGSRMDEVIFEEFKGTGNSE++L+RK++DKR FPA
Sbjct: 301 KRFFGAARNIEEGGSLTIIATALVDTGSRMDEVIFEEFKGTGNSELILDRKVSDKRTFPA 360

Query: 361 MDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           +DI +SGTRKE+L+ + Q L+K+++LRRI++ M + DAI+FL+DKL+ TK+N +FF SMN
Sbjct: 361 IDISRSGTRKEELITDPQVLKKMYVLRRILNPMGTMDAIDFLLDKLRNTKNNSEFFESMN 420


>gi|39933373|ref|NP_945649.1| transcription termination factor Rho [Rhodopseudomonas palustris
           CGA009]
 gi|192288729|ref|YP_001989334.1| transcription termination factor Rho [Rhodopseudomonas palustris
           TIE-1]
 gi|39652998|emb|CAE25740.1| transcription termination factor rho [Rhodopseudomonas palustris
           CGA009]
 gi|192282478|gb|ACE98858.1| transcription termination factor Rho [Rhodopseudomonas palustris
           TIE-1]
          Length = 421

 Score =  668 bits (1724), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/420 (74%), Positives = 379/420 (90%)

Query: 1   MSEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEV 60
           M E+KLQ+LK K+P +L++F+E L +ENA+ MRKQELMF+ LK LS ++ +IIGEGV+EV
Sbjct: 1   MREIKLQDLKAKTPAELVSFSEELGVENASTMRKQELMFACLKQLSAKETDIIGEGVVEV 60

Query: 61  LQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVN 120
           L DGFGFLRSPDANYL GPDDIYVSPSQI+ F L+TGDT+EG IR+P+EGERYFALLKVN
Sbjct: 61  LSDGFGFLRSPDANYLPGPDDIYVSPSQIRRFGLRTGDTIEGHIRSPKEGERYFALLKVN 120

Query: 121 AINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIV 180
           ++NF+ PE+ ++K++FDNLTPL+PD+RF +E+++P  KD+S+RVID++APIGKGQR+LIV
Sbjct: 121 SLNFEDPEKSKHKVNFDNLTPLFPDERFRLEIDDPTRKDLSARVIDIVAPIGKGQRALIV 180

Query: 181 APPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAA 240
           APPRTGKT+L+QNIAHSI  NHPECYLIVLLIDERPEEVTDMQRSV+GEVISSTFDE A 
Sbjct: 181 APPRTGKTVLMQNIAHSITANHPECYLIVLLIDERPEEVTDMQRSVKGEVISSTFDEPAV 240

Query: 241 RHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRP 300
           RHVQVAEMVI KAK LVE+G DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRP
Sbjct: 241 RHVQVAEMVIEKAKRLVEHGRDVVILLDSITRLGRAYNTVVPSSGKVLTGGVDANALQRP 300

Query: 301 KRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPA 360
           KRFFGAARNI+EGGSLTII TALVDTGSRMDEVIFEEFKGTGNSE++L+RK+ADKR FPA
Sbjct: 301 KRFFGAARNIEEGGSLTIIATALVDTGSRMDEVIFEEFKGTGNSELILDRKVADKRTFPA 360

Query: 361 MDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           +DI +SGTRKE+L+ + Q L+K+++LRRI++ M + DAIEFL+DKL+ TK+N +FF SMN
Sbjct: 361 IDISRSGTRKEELITDPQLLKKMYVLRRILNPMGTMDAIEFLLDKLRNTKNNSEFFDSMN 420


>gi|295691560|ref|YP_003595253.1| transcription termination factor Rho [Caulobacter segnis ATCC
           21756]
 gi|295433463|gb|ADG12635.1| transcription termination factor Rho [Caulobacter segnis ATCC
           21756]
          Length = 477

 Score =  668 bits (1723), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/420 (74%), Positives = 366/420 (87%)

Query: 1   MSEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEV 60
           +  M LQELK KSP  LLAFAE+ E+ENAN MRKQ++MF+ILK L+   VEI G G +EV
Sbjct: 57  LKSMSLQELKEKSPADLLAFAETFEVENANSMRKQDMMFAILKTLAEEGVEISGSGTMEV 116

Query: 61  LQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVN 120
           LQDGFGFLRSP+ANYL GPDDIYVSPSQI+ + L+TGD+VEG+IR+PREGERYFAL  V 
Sbjct: 117 LQDGFGFLRSPEANYLPGPDDIYVSPSQIRKYGLRTGDSVEGAIRSPREGERYFALTSVT 176

Query: 121 AINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIV 180
            INF+ PE VR+K+HFDNLTPLYP++R NMEL +P  KD S RVID++AP+GKGQR LIV
Sbjct: 177 KINFESPENVRHKVHFDNLTPLYPEERLNMELPDPTVKDRSGRVIDIVAPLGKGQRCLIV 236

Query: 181 APPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAA 240
           APPR GKT++LQNIA SI+ NHPECYLIVLLIDERPEEVTDMQR+V+GEVI+STFDE A 
Sbjct: 237 APPRVGKTVMLQNIAKSIETNHPECYLIVLLIDERPEEVTDMQRTVKGEVIASTFDEPAT 296

Query: 241 RHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRP 300
           RHVQVAEMVI KAK LVE+  DVVILLDS+TRL RAYN  +PSSGK+LTGGVDANALQRP
Sbjct: 297 RHVQVAEMVIEKAKRLVEHKRDVVILLDSVTRLGRAYNTTVPSSGKVLTGGVDANALQRP 356

Query: 301 KRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPA 360
           KRFFGAARN++EGGSL+II TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RK+ADKRIFPA
Sbjct: 357 KRFFGAARNVEEGGSLSIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKVADKRIFPA 416

Query: 361 MDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           +D++KSGTRKE+L+  R  LQK ++LRRI++ M +SDAIEFL+DKL+Q+K N DFF SMN
Sbjct: 417 IDVLKSGTRKEELITPRDQLQKTYVLRRILNPMGASDAIEFLLDKLRQSKTNGDFFQSMN 476


>gi|323135826|ref|ZP_08070909.1| transcription termination factor Rho [Methylocystis sp. ATCC 49242]
 gi|322398917|gb|EFY01436.1| transcription termination factor Rho [Methylocystis sp. ATCC 49242]
          Length = 422

 Score =  668 bits (1723), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/421 (76%), Positives = 377/421 (89%), Gaps = 1/421 (0%)

Query: 1   MSEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEV 60
           M E+KL +LK+KS  +LLAFAE  E+ENA+++RKQEL+F+ILK  + RDVEI+GEGV+EV
Sbjct: 1   MREIKLSDLKSKSAAELLAFAEEHEVENASLLRKQELLFAILKQFASRDVEIVGEGVVEV 60

Query: 61  LQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVN 120
           LQDGFGFLRSPDANYLAGPDDIYVSPSQI+ F L+TGDTVEG IR+P+EGERYFALLKVN
Sbjct: 61  LQDGFGFLRSPDANYLAGPDDIYVSPSQIRKFGLRTGDTVEGMIRSPKEGERYFALLKVN 120

Query: 121 AINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIV 180
           +INF+ PE+VR+K+ FDNLTPLYPD+R  +E+ +P  KD+SSRVIDL+APIGKGQR+L+V
Sbjct: 121 SINFEDPEKVRHKVPFDNLTPLYPDERLKLEIEDPTKKDLSSRVIDLVAPIGKGQRALVV 180

Query: 181 APPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAA 240
           APPRTGKT+LLQNIA SI  NHPECYLIVLLIDERPEEVTDMQRSV+GEV+SSTFDE A 
Sbjct: 181 APPRTGKTVLLQNIAQSITTNHPECYLIVLLIDERPEEVTDMQRSVRGEVVSSTFDEPAV 240

Query: 241 RHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRP 300
           RHVQVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRP
Sbjct: 241 RHVQVAEMVIEKAKRLVEHRRDVVILLDSITRLGRAYNTVVPSSGKVLTGGVDANALQRP 300

Query: 301 KRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPA 360
           KRFFGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEI+L+RK+ADKR+FPA
Sbjct: 301 KRFFGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIILDRKVADKRVFPA 360

Query: 361 MDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQT-KDNKDFFYSM 419
           +DI +SGTRKE+LLV    L+K+++LRRI++ M  +DAIEFL+ KL++T K N+ FF SM
Sbjct: 361 IDITRSGTRKEELLVAPDILKKMYVLRRILNPMGPADAIEFLLGKLRETPKGNQAFFDSM 420

Query: 420 N 420
           N
Sbjct: 421 N 421


>gi|299133197|ref|ZP_07026392.1| transcription termination factor Rho [Afipia sp. 1NLS2]
 gi|298593334|gb|EFI53534.1| transcription termination factor Rho [Afipia sp. 1NLS2]
          Length = 421

 Score =  667 bits (1722), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/420 (74%), Positives = 378/420 (90%)

Query: 1   MSEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEV 60
           M EMKLQ+LK K+P +L++FAE L +ENA+ MRKQELMF+ILK+L+ ++ +IIGEGV+E+
Sbjct: 1   MREMKLQDLKAKTPAELVSFAEELGVENASTMRKQELMFAILKLLASQETDIIGEGVVEI 60

Query: 61  LQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVN 120
           L DGFGFLRS DANYL GPDDIYVSPSQI+ F L+TGDT+EG IR+P+EGERYFALLKVN
Sbjct: 61  LSDGFGFLRSSDANYLPGPDDIYVSPSQIRRFGLRTGDTIEGQIRSPKEGERYFALLKVN 120

Query: 121 AINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIV 180
            +NF+ PE+ ++K++FDNLTPL+PD+RF +EL++P  KD+S RVID++APIGKGQR+LIV
Sbjct: 121 TLNFEDPEKSKHKVNFDNLTPLFPDERFKLELDDPTRKDLSPRVIDIVAPIGKGQRALIV 180

Query: 181 APPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAA 240
           APPRTGKT+L+QNIAH+I  NHPECYLIVLLIDERPEEVTDMQRSV+GEV+SSTFDE A 
Sbjct: 181 APPRTGKTVLMQNIAHAITTNHPECYLIVLLIDERPEEVTDMQRSVKGEVVSSTFDEPAV 240

Query: 241 RHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRP 300
           RHVQVAEMVI KAK LVE+G DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRP
Sbjct: 241 RHVQVAEMVIEKAKRLVEHGRDVVILLDSITRLGRAYNTVVPSSGKVLTGGVDANALQRP 300

Query: 301 KRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPA 360
           KRFFGAARNI+EGGSLTII TALVDTGSRMDEVIFEEFKGTGNSE++L+RK++DKR FPA
Sbjct: 301 KRFFGAARNIEEGGSLTIIATALVDTGSRMDEVIFEEFKGTGNSELILDRKVSDKRTFPA 360

Query: 361 MDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           +DI +SGTRKE+L+ + Q L+K+++LRRI++ M + DAIEFL+DKL+ TK+N +FF SMN
Sbjct: 361 IDIARSGTRKEELITDPQLLKKMYVLRRILNPMGTMDAIEFLLDKLRSTKNNAEFFDSMN 420


>gi|188580931|ref|YP_001924376.1| transcription termination factor Rho [Methylobacterium populi
           BJ001]
 gi|179344429|gb|ACB79841.1| transcription termination factor Rho [Methylobacterium populi
           BJ001]
          Length = 447

 Score =  666 bits (1719), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/418 (74%), Positives = 372/418 (88%)

Query: 3   EMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQ 62
           E+KLQ+LK+KSPT+L+AFAE +E+ENA+ MRKQELMF+ILK L+  + EIIG G +EVLQ
Sbjct: 29  EVKLQDLKSKSPTELIAFAEEVEVENASTMRKQELMFAILKQLAANETEIIGAGTVEVLQ 88

Query: 63  DGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAI 122
           DGFGFLRS D+NYL GPDDIY+SP+QI+ F L+TGDTVEG IR P++GERYFAL+KVN I
Sbjct: 89  DGFGFLRSNDSNYLPGPDDIYISPTQIRRFGLRTGDTVEGPIRGPKDGERYFALIKVNTI 148

Query: 123 NFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAP 182
           NF+ PE++++K+HFDNLTPL+P KRF +EL+NP  KD S R+ID+++PIGKGQR+LIVAP
Sbjct: 149 NFENPEKIKHKVHFDNLTPLFPTKRFKLELDNPTKKDFSPRIIDIVSPIGKGQRALIVAP 208

Query: 183 PRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARH 242
           PRTGKT+L+QNIA SI  NHPECYLIVLLIDERPEEVTDM RSV+GEVI+STFDE A RH
Sbjct: 209 PRTGKTVLMQNIAQSITLNHPECYLIVLLIDERPEEVTDMIRSVKGEVIASTFDEPATRH 268

Query: 243 VQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKR 302
           VQVAEMVI KAK LVE+G DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRPKR
Sbjct: 269 VQVAEMVIEKAKRLVEHGRDVVILLDSITRLGRAYNTVVPSSGKVLTGGVDANALQRPKR 328

Query: 303 FFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMD 362
           FFGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEI+L+RK++DKRIFPA+D
Sbjct: 329 FFGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIILDRKVSDKRIFPAID 388

Query: 363 IIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           I +SGTRKE+LLV    L+K ++LRRI++ M  +DAIEFL+DKL+QTK N DFF SMN
Sbjct: 389 ITRSGTRKEELLVPPDSLKKTYVLRRILNPMGVTDAIEFLMDKLRQTKSNSDFFDSMN 446


>gi|86747519|ref|YP_484015.1| transcription termination factor Rho [Rhodopseudomonas palustris
           HaA2]
 gi|86570547|gb|ABD05104.1| transcription termination factor Rho [Rhodopseudomonas palustris
           HaA2]
          Length = 421

 Score =  666 bits (1718), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/420 (74%), Positives = 377/420 (89%)

Query: 1   MSEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEV 60
           M EMKL +LK K+P +L++FAE L +ENA+ MRKQELMF+ LK LS ++ +IIGEGV+EV
Sbjct: 1   MREMKLSDLKAKTPAELVSFAEELGVENASTMRKQELMFACLKQLSAKETDIIGEGVVEV 60

Query: 61  LQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVN 120
           L DGFGFLRSPDANYL GPDDIYVSPSQI+ F L+TGDT+EG IR+P+EGERYFALLKVN
Sbjct: 61  LSDGFGFLRSPDANYLPGPDDIYVSPSQIRRFGLRTGDTIEGHIRSPKEGERYFALLKVN 120

Query: 121 AINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIV 180
            +NF+ PE+ ++K++FDNLTPL+PD+RF +E+++P  KD+S+RVID++APIGKGQR+LIV
Sbjct: 121 TLNFEDPEKSKHKVNFDNLTPLFPDERFRLEIDDPTRKDLSARVIDIVAPIGKGQRALIV 180

Query: 181 APPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAA 240
           APPRTGKT+L+QNIAHSI  NHPECYLIVLLIDERPEEVTDMQRSV+GEV+SSTFDE A 
Sbjct: 181 APPRTGKTVLMQNIAHSITANHPECYLIVLLIDERPEEVTDMQRSVKGEVVSSTFDEPAV 240

Query: 241 RHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRP 300
           RHVQVAEMVI KAK LVE+G DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRP
Sbjct: 241 RHVQVAEMVIEKAKRLVEHGRDVVILLDSITRLGRAYNTVVPSSGKVLTGGVDANALQRP 300

Query: 301 KRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPA 360
           KRFFGAARNI+EGGSLTII TALVDTGSRMDEVIFEEFKGTGNSE++L+RK++DKR FPA
Sbjct: 301 KRFFGAARNIEEGGSLTIIATALVDTGSRMDEVIFEEFKGTGNSELILDRKVSDKRTFPA 360

Query: 361 MDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           +DI +SGTRKE+L+ + Q L+K+++LRRI++ M + DAI+FL+DKL+ TK+N +FF SMN
Sbjct: 361 IDISRSGTRKEELITDPQLLKKMYVLRRILNPMGTMDAIDFLLDKLRNTKNNAEFFESMN 420


>gi|92115740|ref|YP_575469.1| transcription termination factor Rho [Nitrobacter hamburgensis X14]
 gi|91798634|gb|ABE61009.1| transcription termination factor Rho [Nitrobacter hamburgensis X14]
          Length = 421

 Score =  666 bits (1718), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/420 (74%), Positives = 378/420 (90%)

Query: 1   MSEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEV 60
           M EMKLQ+LK K+P +L++FAE L +ENA+ MRKQELMF+ILK L+ ++++IIGEGV+EV
Sbjct: 1   MREMKLQDLKAKTPAELVSFAEELGVENASTMRKQELMFAILKQLAIQEIDIIGEGVVEV 60

Query: 61  LQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVN 120
           L DGFGFLRSPDANYL GPDDIYVSPSQI+ F L+TGDT+EG IR+P+EGERYFALLKVN
Sbjct: 61  LSDGFGFLRSPDANYLPGPDDIYVSPSQIRRFGLRTGDTIEGHIRSPKEGERYFALLKVN 120

Query: 121 AINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIV 180
            +NF+ PE+ ++K++FDNLTPL+PD+RF +EL +   KD+S+RVID++APIGKGQR+LIV
Sbjct: 121 TLNFEDPEKSKHKVNFDNLTPLFPDQRFRLELEDSTRKDLSARVIDIVAPIGKGQRALIV 180

Query: 181 APPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAA 240
           APPRTGKT+L+QNIAHSI  NHPECYLIVLLIDERPEEVTDMQRSV+GEV+SSTFDE A 
Sbjct: 181 APPRTGKTVLMQNIAHSITANHPECYLIVLLIDERPEEVTDMQRSVKGEVVSSTFDEPAV 240

Query: 241 RHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRP 300
           RHVQVAEMVI KAK LVE+G DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRP
Sbjct: 241 RHVQVAEMVIEKAKRLVEHGRDVVILLDSITRLGRAYNTVVPSSGKVLTGGVDANALQRP 300

Query: 301 KRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPA 360
           KRFFGAARNI+EGGSLTII TALVDTGSRMDEVIFEEFKGTGNSE++L+RK++DKR FPA
Sbjct: 301 KRFFGAARNIEEGGSLTIIATALVDTGSRMDEVIFEEFKGTGNSELILDRKVSDKRTFPA 360

Query: 361 MDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           +DI +SGTRKE+L+ + Q L+K+++LRRI++ M + DAI+FL+DKL+ TK+N +FF SMN
Sbjct: 361 IDISRSGTRKEELITDPQLLKKMYVLRRILNPMGTMDAIDFLLDKLRNTKNNAEFFESMN 420


>gi|296445000|ref|ZP_06886961.1| transcription termination factor Rho [Methylosinus trichosporium
           OB3b]
 gi|296257421|gb|EFH04487.1| transcription termination factor Rho [Methylosinus trichosporium
           OB3b]
          Length = 422

 Score =  666 bits (1718), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/421 (75%), Positives = 378/421 (89%), Gaps = 1/421 (0%)

Query: 1   MSEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEV 60
           M E+KLQ+LK+KS  +LLAFAE  E+ENA++MR+QEL+F+ILK  +GR+VEI+GEGV+EV
Sbjct: 1   MGEIKLQDLKSKSAAELLAFAEEHEVENASLMRRQELLFAILKQFAGREVEIVGEGVVEV 60

Query: 61  LQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVN 120
           LQDGFGFLRSPDANYLAGPDDIYVSPSQI+ F L+TGDTVEG IR+P+EGERYFALLKVN
Sbjct: 61  LQDGFGFLRSPDANYLAGPDDIYVSPSQIRRFGLRTGDTVEGMIRSPKEGERYFALLKVN 120

Query: 121 AINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIV 180
           +INF+ PE++R+K+ FDNLTPLYPD+R  +E+ +P  +D+S+RVIDL+APIGKGQR+L+V
Sbjct: 121 SINFEDPEKIRHKVPFDNLTPLYPDERLKLEIEDPTRRDLSARVIDLVAPIGKGQRALVV 180

Query: 181 APPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAA 240
           APPRTGKT+LLQNIA SI  NHPECYLIVLLIDERPEEVTDMQRSV+GEV+SSTFDE A 
Sbjct: 181 APPRTGKTVLLQNIAQSITTNHPECYLIVLLIDERPEEVTDMQRSVKGEVVSSTFDEPAV 240

Query: 241 RHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRP 300
           RHVQVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRP
Sbjct: 241 RHVQVAEMVIEKAKRLVEHRRDVVILLDSITRLGRAYNTVVPSSGKVLTGGVDANALQRP 300

Query: 301 KRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPA 360
           KRFFGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEI+L+RK++DKR+FPA
Sbjct: 301 KRFFGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIILDRKVSDKRVFPA 360

Query: 361 MDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQT-KDNKDFFYSM 419
           +DI +SGTRKE+LLV    L+K+++LRRI++ M + DAIEFL+ KL++T K N  FF SM
Sbjct: 361 IDITRSGTRKEELLVPPDILKKMYVLRRILNPMGTVDAIEFLLGKLRETPKGNAAFFDSM 420

Query: 420 N 420
           N
Sbjct: 421 N 421


>gi|16127990|ref|NP_422554.1| transcription termination factor Rho [Caulobacter crescentus CB15]
 gi|13425536|gb|AAK25722.1| transcription termination factor Rho [Caulobacter crescentus CB15]
          Length = 481

 Score =  665 bits (1717), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/420 (74%), Positives = 366/420 (87%)

Query: 1   MSEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEV 60
           +  M LQELK KSP  LLAFAE+ E+ENAN MRKQ++MF+ILK L+   VEI G G +EV
Sbjct: 61  LKSMSLQELKEKSPADLLAFAETFEVENANSMRKQDMMFAILKTLAEEGVEISGSGTMEV 120

Query: 61  LQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVN 120
           LQDGFGFLRSP+ANYL GPDDIYVSPSQI+ + L+TGD+VEG+IR+PREGERYFAL  V 
Sbjct: 121 LQDGFGFLRSPEANYLPGPDDIYVSPSQIRKYGLRTGDSVEGAIRSPREGERYFALTSVT 180

Query: 121 AINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIV 180
            INF+ P+ VR+K+HFDNLTPLYP++R NMEL +P  KD S RVID++AP+GKGQR LIV
Sbjct: 181 KINFESPDNVRHKVHFDNLTPLYPEERLNMELPDPTVKDRSGRVIDIVAPLGKGQRCLIV 240

Query: 181 APPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAA 240
           APPR GKT++LQNIA SI+ NHPECYLIVLLIDERPEEVTDMQR+V+GEVI+STFDE A 
Sbjct: 241 APPRVGKTVMLQNIAKSIETNHPECYLIVLLIDERPEEVTDMQRTVKGEVIASTFDEPAT 300

Query: 241 RHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRP 300
           RHVQVAEMVI KAK LVE+  DVVILLDS+TRL RAYN  +PSSGK+LTGGVDANALQRP
Sbjct: 301 RHVQVAEMVIEKAKRLVEHKRDVVILLDSVTRLGRAYNTTVPSSGKVLTGGVDANALQRP 360

Query: 301 KRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPA 360
           KRFFGAARN++EGGSL+II TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RK+ADKRIFPA
Sbjct: 361 KRFFGAARNVEEGGSLSIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKVADKRIFPA 420

Query: 361 MDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           +D++KSGTRKE+L+  R  LQK ++LRRI++ M +SDAIEFL+DKL+Q+K N DFF SMN
Sbjct: 421 IDVLKSGTRKEELITPRDQLQKTYVLRRILNPMGASDAIEFLLDKLRQSKTNGDFFQSMN 480


>gi|304570815|ref|YP_002519249.2| transcription termination factor Rho [Caulobacter crescentus
           NA1000]
          Length = 477

 Score =  665 bits (1716), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/420 (74%), Positives = 366/420 (87%)

Query: 1   MSEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEV 60
           +  M LQELK KSP  LLAFAE+ E+ENAN MRKQ++MF+ILK L+   VEI G G +EV
Sbjct: 57  LKSMSLQELKEKSPADLLAFAETFEVENANSMRKQDMMFAILKTLAEEGVEISGSGTMEV 116

Query: 61  LQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVN 120
           LQDGFGFLRSP+ANYL GPDDIYVSPSQI+ + L+TGD+VEG+IR+PREGERYFAL  V 
Sbjct: 117 LQDGFGFLRSPEANYLPGPDDIYVSPSQIRKYGLRTGDSVEGAIRSPREGERYFALTSVT 176

Query: 121 AINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIV 180
            INF+ P+ VR+K+HFDNLTPLYP++R NMEL +P  KD S RVID++AP+GKGQR LIV
Sbjct: 177 KINFESPDNVRHKVHFDNLTPLYPEERLNMELPDPTVKDRSGRVIDIVAPLGKGQRCLIV 236

Query: 181 APPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAA 240
           APPR GKT++LQNIA SI+ NHPECYLIVLLIDERPEEVTDMQR+V+GEVI+STFDE A 
Sbjct: 237 APPRVGKTVMLQNIAKSIETNHPECYLIVLLIDERPEEVTDMQRTVKGEVIASTFDEPAT 296

Query: 241 RHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRP 300
           RHVQVAEMVI KAK LVE+  DVVILLDS+TRL RAYN  +PSSGK+LTGGVDANALQRP
Sbjct: 297 RHVQVAEMVIEKAKRLVEHKRDVVILLDSVTRLGRAYNTTVPSSGKVLTGGVDANALQRP 356

Query: 301 KRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPA 360
           KRFFGAARN++EGGSL+II TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RK+ADKRIFPA
Sbjct: 357 KRFFGAARNVEEGGSLSIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKVADKRIFPA 416

Query: 361 MDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           +D++KSGTRKE+L+  R  LQK ++LRRI++ M +SDAIEFL+DKL+Q+K N DFF SMN
Sbjct: 417 IDVLKSGTRKEELITPRDQLQKTYVLRRILNPMGASDAIEFLLDKLRQSKTNGDFFQSMN 476


>gi|197106992|ref|YP_002132369.1| probable transcription termination factor RHO protein
           [Phenylobacterium zucineum HLK1]
 gi|196480412|gb|ACG79940.1| probable transcription termination factor RHO protein
           [Phenylobacterium zucineum HLK1]
          Length = 474

 Score =  665 bits (1715), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/420 (74%), Positives = 372/420 (88%)

Query: 1   MSEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEV 60
           ++ M LQELK+KSP+ LLAFAE LE+E+AN MRKQ++MF+ILK L+   VEI G G +EV
Sbjct: 54  LTRMSLQELKDKSPSDLLAFAEQLEVESANSMRKQDMMFAILKTLAEEGVEIEGSGTLEV 113

Query: 61  LQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVN 120
           +QDGFGFLRSP+ANYL GPDDIYVSPSQI+ F L+TGDTV G++RAPREGERYFAL+KV+
Sbjct: 114 VQDGFGFLRSPEANYLPGPDDIYVSPSQIRKFGLRTGDTVVGAVRAPREGERYFALVKVD 173

Query: 121 AINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIV 180
            INF+ PE VR+K+ FDNLTPLYPD+R  ME+++P  KD S RVID++AP+GKGQR LIV
Sbjct: 174 QINFEPPENVRHKVLFDNLTPLYPDERLRMEIDDPTLKDRSGRVIDIVAPLGKGQRCLIV 233

Query: 181 APPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAA 240
           APPR GKT++LQNIA SI+KNHPECYLIVLLIDERPEEVTDMQR+V+GEVISSTFDE A 
Sbjct: 234 APPRVGKTVMLQNIAKSIEKNHPECYLIVLLIDERPEEVTDMQRTVKGEVISSTFDEPAT 293

Query: 241 RHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRP 300
           RHVQVAEMVI KAK LVE+  DVVILLDS+TRL RAYN ++PSSGK+LTGGVDANALQRP
Sbjct: 294 RHVQVAEMVIEKAKRLVEHKRDVVILLDSVTRLGRAYNTVVPSSGKVLTGGVDANALQRP 353

Query: 301 KRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPA 360
           KRFFGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RK+ADKRIFPA
Sbjct: 354 KRFFGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKVADKRIFPA 413

Query: 361 MDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           +D++KSGTRKE+L+  ++ LQK ++LRRI++ M + DAIEFL+DKL+ +K+N DFF SMN
Sbjct: 414 IDVLKSGTRKEELITPKEHLQKTYILRRILNPMGAQDAIEFLLDKLRGSKNNDDFFQSMN 473


>gi|90421816|ref|YP_530186.1| transcription termination factor Rho [Rhodopseudomonas palustris
           BisB18]
 gi|90103830|gb|ABD85867.1| transcription termination factor Rho [Rhodopseudomonas palustris
           BisB18]
          Length = 421

 Score =  663 bits (1711), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/420 (74%), Positives = 376/420 (89%)

Query: 1   MSEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEV 60
           M EMKLQ+LK K+P +L++FAE L +ENA+ MRKQELMF+ LK L+ ++ +IIGEGV+EV
Sbjct: 1   MREMKLQDLKAKTPAELVSFAEELGVENASTMRKQELMFASLKQLAIKETDIIGEGVVEV 60

Query: 61  LQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVN 120
           L DGFGFLRSPDANYL GPDDIYVSPSQI+ F L+TGDT+EG IR+P+EGERYFALLKVN
Sbjct: 61  LSDGFGFLRSPDANYLPGPDDIYVSPSQIRRFGLRTGDTIEGHIRSPKEGERYFALLKVN 120

Query: 121 AINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIV 180
            +NF+ PE+ ++K++FDNLTPL+PD+RF +EL +   KD+S+RVID++APIGKGQR+LIV
Sbjct: 121 TLNFEDPEKSKHKVNFDNLTPLFPDQRFRLELEDSSRKDLSARVIDIVAPIGKGQRALIV 180

Query: 181 APPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAA 240
           APPRTGKT+L+QNIAHSI  NHPECYLIVLLIDERPEEVTDMQRSV+GEV+SSTFDE A 
Sbjct: 181 APPRTGKTVLMQNIAHSITANHPECYLIVLLIDERPEEVTDMQRSVKGEVVSSTFDEPAV 240

Query: 241 RHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRP 300
           RHVQVAEMVI KAK LVE+G DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRP
Sbjct: 241 RHVQVAEMVIEKAKRLVEHGRDVVILLDSITRLGRAYNTVVPSSGKVLTGGVDANALQRP 300

Query: 301 KRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPA 360
           KRFFGAARNI+EGGSLTII TALVDTGSRMDEVIFEEFKGTGNSE++L+RK++DKR FPA
Sbjct: 301 KRFFGAARNIEEGGSLTIIATALVDTGSRMDEVIFEEFKGTGNSELILDRKVSDKRTFPA 360

Query: 361 MDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           +DI +SGTRKE+L+ + Q L+K+++LRRI++ M + DAI+FL+DKL+ TK+N +FF SMN
Sbjct: 361 IDISRSGTRKEELITDPQLLKKMYVLRRILNPMGTMDAIDFLLDKLRNTKNNAEFFESMN 420


>gi|83944963|ref|ZP_00957329.1| transcription termination factor Rho [Oceanicaulis alexandrii
           HTCC2633]
 gi|83851745|gb|EAP89600.1| transcription termination factor Rho [Oceanicaulis alexandrii
           HTCC2633]
          Length = 418

 Score =  663 bits (1711), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/417 (74%), Positives = 372/417 (89%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M LQELK KSP +L+  AESL+IENA+ +RKQ +MF+ILK L+    EI G G +EVLQD
Sbjct: 1   MSLQELKEKSPAELVELAESLDIENASSLRKQGMMFAILKALADEGAEISGGGTLEVLQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLR+P++NYL GPDDIYVSPSQI+ F L+TGDTVEG IRAPR+ ERYFALLKV++IN
Sbjct: 61  GFGFLRAPESNYLPGPDDIYVSPSQIRRFGLRTGDTVEGEIRAPRDNERYFALLKVSSIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           F+ PE+ R+K+HFDNLTPLYPD+RFNME+ +P  KD S RVID+++P+GKGQR+LIVAPP
Sbjct: 121 FEEPEKSRHKVHFDNLTPLYPDERFNMEIQDPTKKDRSGRVIDIVSPLGKGQRALIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           RTGKT+L+QN+AH+I+ NHPECYL+VLLIDERPEEVTDMQR+V+GEV++STFDE A RHV
Sbjct: 181 RTGKTVLMQNVAHAIETNHPECYLMVLLIDERPEEVTDMQRTVKGEVVASTFDEPATRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKRDVVILLDSITRLGRAYNTVVPSSGKVLTGGVDANALQRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEI+L+RK+ADKR+FPA+DI
Sbjct: 301 FGAARNIEEGGSLTIISTALIDTGSRMDEVIFEEFKGTGNSEIILDRKVADKRVFPAIDI 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           +KSGTRKE+LLV +QDLQK ++LRRI++ M + DAIEFL+ KLK+TK+N +F+ SMN
Sbjct: 361 LKSGTRKEELLVPKQDLQKTYVLRRILNPMGTQDAIEFLLSKLKETKNNAEFYDSMN 417


>gi|315497191|ref|YP_004085995.1| transcription termination factor rho [Asticcacaulis excentricus CB
           48]
 gi|315415203|gb|ADU11844.1| transcription termination factor Rho [Asticcacaulis excentricus CB
           48]
          Length = 455

 Score =  662 bits (1708), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/418 (75%), Positives = 366/418 (87%)

Query: 3   EMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQ 62
           ++ LQELK+KSP  LLAFAE + +ENA  MR Q+LMF++LK L+   VEI G GVIEVLQ
Sbjct: 37  KLSLQELKDKSPADLLAFAEQIGVENAASMRMQDLMFAVLKTLAEEGVEITGSGVIEVLQ 96

Query: 63  DGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAI 122
           DGFGFLRSP+ANYL GPDDIYVSP QI+  +L+TGDTVEG IR+PREGERYFAL K+  I
Sbjct: 97  DGFGFLRSPEANYLPGPDDIYVSPQQIRRHALRTGDTVEGPIRSPREGERYFALSKIKTI 156

Query: 123 NFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAP 182
           NF+ PE +R+K+HFDNLTPLYP++R  ME+ +P  KD S R+ID++AP+GKGQR LIVAP
Sbjct: 157 NFEDPEAIRHKVHFDNLTPLYPEERLKMEIEDPTIKDRSGRIIDIVAPLGKGQRCLIVAP 216

Query: 183 PRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARH 242
           PR GKT++LQNIA SI  NHPECYL+VLLIDERPEEVTDMQR+V+GEVISSTFDE A RH
Sbjct: 217 PRVGKTVMLQNIAKSIAANHPECYLMVLLIDERPEEVTDMQRTVRGEVISSTFDEPATRH 276

Query: 243 VQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKR 302
           VQVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRPKR
Sbjct: 277 VQVAEMVIEKAKRLVEHKRDVVILLDSITRLGRAYNTVVPSSGKVLTGGVDANALQRPKR 336

Query: 303 FFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMD 362
           FFGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RK+ADKR+FPAMD
Sbjct: 337 FFGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKVADKRVFPAMD 396

Query: 363 IIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           I+KSGTRKEDLLV++ DLQK ++LRRI++ M + DAIEFLIDKL+QTK+N +FF SMN
Sbjct: 397 ILKSGTRKEDLLVDKSDLQKTYVLRRILNPMGAQDAIEFLIDKLRQTKNNGEFFQSMN 454


>gi|220965985|gb|ACL97341.1| transcription termination factor rho [Caulobacter crescentus
           NA1000]
          Length = 418

 Score =  662 bits (1708), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/417 (74%), Positives = 365/417 (87%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M LQELK KSP  LLAFAE+ E+ENAN MRKQ++MF+ILK L+   VEI G G +EVLQD
Sbjct: 1   MSLQELKEKSPADLLAFAETFEVENANSMRKQDMMFAILKTLAEEGVEISGSGTMEVLQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSP+ANYL GPDDIYVSPSQI+ + L+TGD+VEG+IR+PREGERYFAL  V  IN
Sbjct: 61  GFGFLRSPEANYLPGPDDIYVSPSQIRKYGLRTGDSVEGAIRSPREGERYFALTSVTKIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           F+ P+ VR+K+HFDNLTPLYP++R NMEL +P  KD S RVID++AP+GKGQR LIVAPP
Sbjct: 121 FESPDNVRHKVHFDNLTPLYPEERLNMELPDPTVKDRSGRVIDIVAPLGKGQRCLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           R GKT++LQNIA SI+ NHPECYLIVLLIDERPEEVTDMQR+V+GEVI+STFDE A RHV
Sbjct: 181 RVGKTVMLQNIAKSIETNHPECYLIVLLIDERPEEVTDMQRTVKGEVIASTFDEPATRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDS+TRL RAYN  +PSSGK+LTGGVDANALQRPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKRDVVILLDSVTRLGRAYNTTVPSSGKVLTGGVDANALQRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSL+II TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RK+ADKRIFPA+D+
Sbjct: 301 FGAARNVEEGGSLSIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKVADKRIFPAIDV 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           +KSGTRKE+L+  R  LQK ++LRRI++ M +SDAIEFL+DKL+Q+K N DFF SMN
Sbjct: 361 LKSGTRKEELITPRDQLQKTYVLRRILNPMGASDAIEFLLDKLRQSKTNGDFFQSMN 417


>gi|27375746|ref|NP_767275.1| transcription termination factor Rho [Bradyrhizobium japonicum USDA
           110]
 gi|27348884|dbj|BAC45900.1| transcription termination factor [Bradyrhizobium japonicum USDA
           110]
          Length = 421

 Score =  662 bits (1707), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/420 (73%), Positives = 377/420 (89%)

Query: 1   MSEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEV 60
           M E+KLQ+LK+K+P +L++FAE   +ENA+ MRKQEL+F+ILK LS  + +I+GEGV+EV
Sbjct: 1   MREIKLQDLKSKTPAELVSFAEENGVENASTMRKQELLFAILKQLSLAETDIVGEGVVEV 60

Query: 61  LQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVN 120
           L DGFGFLRSPDANYL GPDDIYVSPSQI+ F L+TGDT+EG IR+P+EGERYFALLKVN
Sbjct: 61  LSDGFGFLRSPDANYLPGPDDIYVSPSQIRRFGLRTGDTIEGHIRSPKEGERYFALLKVN 120

Query: 121 AINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIV 180
            +NF+ PE+ ++K++FDNLTPL+P++RF ME+++P  KD+S+RVID++APIGKGQR+LIV
Sbjct: 121 TLNFEDPEKAKHKVNFDNLTPLFPNQRFRMEIDDPTRKDLSARVIDIVAPIGKGQRALIV 180

Query: 181 APPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAA 240
           APPRTGKT+L+QNIAHSI  NHPECYLIVLLIDERPEEVTDMQRSV+GEV+SSTFDE A 
Sbjct: 181 APPRTGKTVLMQNIAHSITHNHPECYLIVLLIDERPEEVTDMQRSVKGEVVSSTFDEPAV 240

Query: 241 RHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRP 300
           RHVQVAEMVI KAK LVE+G DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRP
Sbjct: 241 RHVQVAEMVIEKAKRLVEHGRDVVILLDSITRLGRAYNTVVPSSGKVLTGGVDANALQRP 300

Query: 301 KRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPA 360
           KRFFGAARNI+EGGSLTII TALVDTGSRMDEVIFEEFKGTGNSE++L+RK++DKR FPA
Sbjct: 301 KRFFGAARNIEEGGSLTIIATALVDTGSRMDEVIFEEFKGTGNSELILDRKVSDKRTFPA 360

Query: 361 MDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           +DI +SGTRKE+L+ + Q L+K+++LRRI++ M + DAI+FL+DKL+ TK N +FF SMN
Sbjct: 361 IDISRSGTRKEELITDPQVLKKMYVLRRILNPMGTMDAIDFLLDKLRSTKSNSEFFDSMN 420


>gi|167648974|ref|YP_001686637.1| transcription termination factor Rho [Caulobacter sp. K31]
 gi|167351404|gb|ABZ74139.1| transcription termination factor Rho [Caulobacter sp. K31]
          Length = 473

 Score =  660 bits (1703), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/420 (73%), Positives = 366/420 (87%)

Query: 1   MSEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEV 60
           +  M LQELK KSP  LLAFAE+ E+ENAN MRKQ++MF+ILK L+   VEI G G +EV
Sbjct: 53  LKTMSLQELKEKSPADLLAFAETFEVENANSMRKQDMMFAILKTLAEEGVEISGSGTMEV 112

Query: 61  LQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVN 120
           +QDGFGFLRSP+ANYL GPDDIYVSPSQI+ F L+TGDT++G+IRAPREGERYFAL  V 
Sbjct: 113 VQDGFGFLRSPEANYLPGPDDIYVSPSQIRKFGLRTGDTIDGAIRAPREGERYFALTGVT 172

Query: 121 AINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIV 180
            INF+ P+ V++K+HFDNLTPLYP++R NMEL +P  KD S RVID++AP+GKGQR LIV
Sbjct: 173 LINFESPDNVKHKVHFDNLTPLYPEERLNMELPDPTIKDRSGRVIDIVAPLGKGQRCLIV 232

Query: 181 APPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAA 240
           APPR GKT++LQNIA SI+ NHPECYLIVLLIDERPEEVTDMQR+V+GEVI+STFDE A 
Sbjct: 233 APPRVGKTVMLQNIAKSIETNHPECYLIVLLIDERPEEVTDMQRTVKGEVIASTFDEPAT 292

Query: 241 RHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRP 300
           RHVQVAEMVI KAK LVE+  DVVILLDS+TRL RAYN  +PSSGK+LTGGVDANALQRP
Sbjct: 293 RHVQVAEMVIEKAKRLVEHKRDVVILLDSVTRLGRAYNTTVPSSGKVLTGGVDANALQRP 352

Query: 301 KRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPA 360
           KRFFGAARN++EGGSL+II TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RK+ADKRIFPA
Sbjct: 353 KRFFGAARNVEEGGSLSIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKVADKRIFPA 412

Query: 361 MDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           +D++KSGTRKE+L+  R  LQK ++LRRI++ M +SDAIEFL++K++Q+K N DFF SMN
Sbjct: 413 IDVLKSGTRKEELITPRDQLQKTYVLRRILNPMGASDAIEFLLEKMRQSKTNGDFFQSMN 472


>gi|154245768|ref|YP_001416726.1| transcription termination factor Rho [Xanthobacter autotrophicus
           Py2]
 gi|154159853|gb|ABS67069.1| transcription termination factor Rho [Xanthobacter autotrophicus
           Py2]
          Length = 422

 Score =  660 bits (1703), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/421 (74%), Positives = 371/421 (88%), Gaps = 1/421 (0%)

Query: 1   MSEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEV 60
           M E+KLQ+LK+K+P +LLAFAE  ++ENA+ +RKQELMF+ILK L+  + EIIGEGV+EV
Sbjct: 1   MREVKLQDLKSKTPVELLAFAEESQVENASTLRKQELMFAILKQLAATETEIIGEGVVEV 60

Query: 61  LQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVN 120
           LQDGFGFLRSP+ANYL GPDDIYVSPSQI+ F L+TGDTVEG IR+P+EGERYFALLKVN
Sbjct: 61  LQDGFGFLRSPEANYLPGPDDIYVSPSQIRRFGLRTGDTVEGQIRSPKEGERYFALLKVN 120

Query: 121 AINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNP-ENKDISSRVIDLIAPIGKGQRSLI 179
            INF+ PE+ R+KI+FDNLTPLYPD+R  +E       KD S R+ID++APIGKGQR LI
Sbjct: 121 TINFEDPEKTRHKINFDNLTPLYPDERLKLEHEETVGKKDFSPRIIDIVAPIGKGQRGLI 180

Query: 180 VAPPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESA 239
           VAPPRTGKT+LLQNIA SI  NHPEC+LIVLLIDERPEEVTDMQRSV+GEV+SSTFDE A
Sbjct: 181 VAPPRTGKTVLLQNIAKSITANHPECFLIVLLIDERPEEVTDMQRSVKGEVVSSTFDEPA 240

Query: 240 ARHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQR 299
            RHVQVAEMVI KAK LVE+G DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQR
Sbjct: 241 TRHVQVAEMVIEKAKRLVEHGRDVVILLDSITRLGRAYNTVVPSSGKVLTGGVDANALQR 300

Query: 300 PKRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFP 359
           PKRFFGAARNI+EGGSLTII TAL++TGSRMDEVIFEEFKGTGNSE++L+RK++DKR+FP
Sbjct: 301 PKRFFGAARNIEEGGSLTIIATALIETGSRMDEVIFEEFKGTGNSEVILDRKVSDKRVFP 360

Query: 360 AMDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSM 419
           A+DI +SGTRKE+LLV    L+K+++LRRI++ M + DAIEFL+DKL+QTK N DFF SM
Sbjct: 361 AIDITRSGTRKEELLVPADTLKKMYVLRRILNPMGTVDAIEFLLDKLRQTKTNADFFDSM 420

Query: 420 N 420
           N
Sbjct: 421 N 421


>gi|158426339|ref|YP_001527631.1| transcription termination factor Rho [Azorhizobium caulinodans ORS
           571]
 gi|158333228|dbj|BAF90713.1| transcription termination factor protein [Azorhizobium caulinodans
           ORS 571]
          Length = 423

 Score =  660 bits (1702), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/422 (74%), Positives = 374/422 (88%), Gaps = 2/422 (0%)

Query: 1   MSEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEV 60
           M E+KLQ+LK+K+P +LLAFAE  ++ENA+ +RKQELMF+ILK L+  + +IIG GV+EV
Sbjct: 1   MREVKLQDLKSKTPVELLAFAEENQVENASTLRKQELMFAILKQLAATETDIIGTGVVEV 60

Query: 61  LQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVN 120
           LQDGFGFLRSPDANYL GPDDIYVSPSQI+ F L+TGDTVEG IR+P+EGERYFALLKVN
Sbjct: 61  LQDGFGFLRSPDANYLPGPDDIYVSPSQIRRFGLRTGDTVEGQIRSPKEGERYFALLKVN 120

Query: 121 AINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPEN--KDISSRVIDLIAPIGKGQRSL 178
            INF+ PE+ ++KI+FDNLTPLYPD+R  +E+ +     KD S+R+ID ++PIGKGQR L
Sbjct: 121 TINFEDPEKTKHKINFDNLTPLYPDERLKLEVEDTTGTKKDFSARIIDTVSPIGKGQRGL 180

Query: 179 IVAPPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDES 238
           IVAPPRTGKT+LLQNIA SI  NHPEC+LIVLLIDERPEEVTDMQRSV+GEVISSTFDE 
Sbjct: 181 IVAPPRTGKTVLLQNIAKSITANHPECFLIVLLIDERPEEVTDMQRSVKGEVISSTFDEP 240

Query: 239 AARHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQ 298
           A+RHVQVAEMVI KAK LVE+G DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQ
Sbjct: 241 ASRHVQVAEMVIEKAKRLVEHGRDVVILLDSITRLGRAYNTVVPSSGKVLTGGVDANALQ 300

Query: 299 RPKRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIF 358
           RPKRFFGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSE++L+RK++DKR+F
Sbjct: 301 RPKRFFGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEVILDRKVSDKRVF 360

Query: 359 PAMDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYS 418
           PA+DI +SGTRKE+LLV    L+K+++LRRI++ M + DAIEFL+DKL+QTK N+DFF S
Sbjct: 361 PAIDITRSGTRKEELLVPADVLKKMYVLRRILNPMGTVDAIEFLMDKLRQTKTNQDFFDS 420

Query: 419 MN 420
           MN
Sbjct: 421 MN 422


>gi|163850990|ref|YP_001639033.1| transcription termination factor Rho [Methylobacterium extorquens
           PA1]
 gi|163662595|gb|ABY29962.1| transcription termination factor Rho [Methylobacterium extorquens
           PA1]
          Length = 506

 Score =  660 bits (1702), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/418 (74%), Positives = 370/418 (88%)

Query: 3   EMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQ 62
           E+KLQ+LK+K+PT+L AFAE + +ENA+ MRKQELMF+ILK L+  + EIIG G +EVLQ
Sbjct: 88  EVKLQDLKSKTPTELTAFAEEVGVENASTMRKQELMFAILKQLAANETEIIGAGTVEVLQ 147

Query: 63  DGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAI 122
           DGFGFLRS D+NYL GPDDIY+SP+QI+ F L+TGDTVEG IR P++GERYFALLKVN I
Sbjct: 148 DGFGFLRSHDSNYLPGPDDIYISPTQIRRFGLRTGDTVEGPIRGPKDGERYFALLKVNTI 207

Query: 123 NFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAP 182
           NF+ PE++++K+HFDNLTPL+P +RF +EL+NP  KD S R+ID+++PIGKGQR+LIVAP
Sbjct: 208 NFENPEKIKHKVHFDNLTPLFPTQRFKLELDNPPKKDFSPRIIDIVSPIGKGQRALIVAP 267

Query: 183 PRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARH 242
           PRTGKT+L+QNIA SI  NHPECYLIVLLIDERPEEVTDM RSV+GEVI+STFDE A RH
Sbjct: 268 PRTGKTVLMQNIAQSITINHPECYLIVLLIDERPEEVTDMIRSVKGEVIASTFDEPATRH 327

Query: 243 VQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKR 302
           VQVAEMVI KAK LVE+G DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRPKR
Sbjct: 328 VQVAEMVIEKAKRLVEHGRDVVILLDSITRLGRAYNTVVPSSGKVLTGGVDANALQRPKR 387

Query: 303 FFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMD 362
           FFGAARNI+EGGSL+II TAL+DTGSRMDEVIFEEFKGTGNSEI+L+RK++DKRIFPA+D
Sbjct: 388 FFGAARNIEEGGSLSIIATALIDTGSRMDEVIFEEFKGTGNSEIILDRKVSDKRIFPAID 447

Query: 363 IIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           I +SGTRKE+LLV    L+K ++LRRI++ M  +DAIEFL+DKL+QTK N DFF SMN
Sbjct: 448 ITRSGTRKEELLVPPDALKKTYVLRRILNPMGVTDAIEFLMDKLRQTKSNGDFFDSMN 505


>gi|218529817|ref|YP_002420633.1| transcription termination factor Rho [Methylobacterium
           chloromethanicum CM4]
 gi|240138121|ref|YP_002962593.1| transcription termination factor Rho; polarity suppressor
           [Methylobacterium extorquens AM1]
 gi|254560683|ref|YP_003067778.1| transcription termination factor Rho; polarity suppressor
           [Methylobacterium extorquens DM4]
 gi|218522120|gb|ACK82705.1| transcription termination factor Rho [Methylobacterium
           chloromethanicum CM4]
 gi|240008090|gb|ACS39316.1| transcription termination factor Rho; polarity suppressor
           [Methylobacterium extorquens AM1]
 gi|254267961|emb|CAX23829.1| transcription termination factor Rho; polarity suppressor
           [Methylobacterium extorquens DM4]
          Length = 447

 Score =  659 bits (1701), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/418 (74%), Positives = 370/418 (88%)

Query: 3   EMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQ 62
           E+KLQ+LK+K+PT+L AFAE + +ENA+ MRKQELMF+ILK L+  + EIIG G +EVLQ
Sbjct: 29  EVKLQDLKSKTPTELTAFAEEVGVENASTMRKQELMFAILKQLAANETEIIGAGTVEVLQ 88

Query: 63  DGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAI 122
           DGFGFLRS D+NYL GPDDIY+SP+QI+ F L+TGDTVEG IR P++GERYFALLKVN I
Sbjct: 89  DGFGFLRSHDSNYLPGPDDIYISPTQIRRFGLRTGDTVEGPIRGPKDGERYFALLKVNTI 148

Query: 123 NFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAP 182
           NF+ PE++++K+HFDNLTPL+P +RF +EL+NP  KD S R+ID+++PIGKGQR+LIVAP
Sbjct: 149 NFENPEKIKHKVHFDNLTPLFPTQRFKLELDNPPKKDFSPRIIDIVSPIGKGQRALIVAP 208

Query: 183 PRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARH 242
           PRTGKT+L+QNIA SI  NHPECYLIVLLIDERPEEVTDM RSV+GEVI+STFDE A RH
Sbjct: 209 PRTGKTVLMQNIAQSITINHPECYLIVLLIDERPEEVTDMIRSVKGEVIASTFDEPATRH 268

Query: 243 VQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKR 302
           VQVAEMVI KAK LVE+G DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRPKR
Sbjct: 269 VQVAEMVIEKAKRLVEHGRDVVILLDSITRLGRAYNTVVPSSGKVLTGGVDANALQRPKR 328

Query: 303 FFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMD 362
           FFGAARNI+EGGSL+II TAL+DTGSRMDEVIFEEFKGTGNSEI+L+RK++DKRIFPA+D
Sbjct: 329 FFGAARNIEEGGSLSIIATALIDTGSRMDEVIFEEFKGTGNSEIILDRKVSDKRIFPAID 388

Query: 363 IIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           I +SGTRKE+LLV    L+K ++LRRI++ M  +DAIEFL+DKL+QTK N DFF SMN
Sbjct: 389 ITRSGTRKEELLVPPDALKKTYVLRRILNPMGVTDAIEFLMDKLRQTKSNGDFFDSMN 446


>gi|329847384|ref|ZP_08262412.1| transcription termination factor Rho [Asticcacaulis biprosthecum
           C19]
 gi|328842447|gb|EGF92016.1| transcription termination factor Rho [Asticcacaulis biprosthecum
           C19]
          Length = 418

 Score =  659 bits (1699), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/417 (75%), Positives = 364/417 (87%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M LQ LK+KSPT L+ FAE L IENA+ +RKQ+LMF++LK L+   VEI G GVIEVLQD
Sbjct: 1   MSLQTLKDKSPTDLVTFAEGLGIENASNLRKQDLMFAVLKALAEDGVEITGSGVIEVLQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSP+ANYL GPDDIYVSP QI+   L+TGDTVEG IR+PREGERYFALLK+  IN
Sbjct: 61  GFGFLRSPEANYLPGPDDIYVSPLQIRRHGLRTGDTVEGPIRSPREGERYFALLKIQTIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           F+ PE +R+K+HFDNLTPLYP+KR  ME+ +P  KD S R+ID++AP+GKGQR LIVAPP
Sbjct: 121 FEDPENIRHKVHFDNLTPLYPEKRLWMEIEDPTLKDRSGRIIDIVAPLGKGQRCLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           R GKT++LQNIA S+  NHP+CYLIVLLIDERPEEVTDMQR+V+GEVISSTFDE A RHV
Sbjct: 181 RVGKTMMLQNIAKSVAANHPDCYLIVLLIDERPEEVTDMQRTVRGEVISSTFDEPATRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKRDVVILLDSITRLGRAYNTVVPSSGKVLTGGVDANALQRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RK+ADKR+FPAMD+
Sbjct: 301 FGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKVADKRVFPAMDV 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           +KSGTRKEDLL ++ +LQK ++LRRI++ M + DAIEFLIDKL+QTK N +FF SMN
Sbjct: 361 LKSGTRKEDLLTDKSNLQKTYVLRRILNPMGAQDAIEFLIDKLRQTKSNAEFFQSMN 417


>gi|288959731|ref|YP_003450072.1| transcription termination factor Rho [Azospirillum sp. B510]
 gi|288912039|dbj|BAI73528.1| transcription termination factor Rho [Azospirillum sp. B510]
          Length = 478

 Score =  654 bits (1688), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/418 (73%), Positives = 369/418 (88%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M LQELK KSP +LLAFAE L+IENA+ +RKQ++MF+ILK L+  D+ I G+GV+EVLQD
Sbjct: 61  MHLQELKCKSPAELLAFAEELQIENASTLRKQDMMFAILKQLAENDIPIFGDGVLEVLQD 120

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSP+ANYL GPDDIYVSPSQ++ F L+TGDTVEG IR+P++GERYFALLKVN IN
Sbjct: 121 GFGFLRSPEANYLPGPDDIYVSPSQVRRFGLRTGDTVEGQIRSPKDGERYFALLKVNTIN 180

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           FD P++VR++I+FDNLTPLYP++R  ME+ +P  K+++ R++DL++P+GKGQR LIVAPP
Sbjct: 181 FDAPDKVRHRINFDNLTPLYPEERIRMEVEDPTKKNLTGRIVDLVSPLGKGQRGLIVAPP 240

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           RTGKT++LQNIAHSI  NHPE YLIVLLIDERPEEVTDM RSV+GEVISSTFDE A RHV
Sbjct: 241 RTGKTVMLQNIAHSIATNHPEAYLIVLLIDERPEEVTDMARSVRGEVISSTFDEPATRHV 300

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRPKRF
Sbjct: 301 QVAEMVIEKAKRLVEHKRDVVILLDSITRLARAYNTVVPSSGKVLTGGVDANALQRPKRF 360

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RK++DKR FPA+DI
Sbjct: 361 FGAARNVEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKLSDKRTFPAIDI 420

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            KSGTRKE+LLV++  + K+++LRRI+  M  +DA++FL+DKLK TK N +FF SMN+
Sbjct: 421 SKSGTRKEELLVDKGTMSKMWILRRILMPMGVTDAVDFLVDKLKHTKSNNEFFESMNQ 478


>gi|300024780|ref|YP_003757391.1| transcription termination factor Rho [Hyphomicrobium denitrificans
           ATCC 51888]
 gi|299526601|gb|ADJ25070.1| transcription termination factor Rho [Hyphomicrobium denitrificans
           ATCC 51888]
          Length = 421

 Score =  654 bits (1687), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/420 (73%), Positives = 368/420 (87%)

Query: 1   MSEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEV 60
           M +MKL++LK KSP +L+ FAE   +ENA+ +RKQELMF+ LK L+ ++ EI   GV+EV
Sbjct: 1   MKQMKLEDLKRKSPAELVTFAEETGVENASTLRKQELMFATLKQLATQETEITATGVVEV 60

Query: 61  LQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVN 120
           LQDGFGFLRSP+ANYL GPDDIYVSPSQI+ F+L+TGDTVEG IR+P++GERYFALLKV+
Sbjct: 61  LQDGFGFLRSPEANYLPGPDDIYVSPSQIRRFALRTGDTVEGQIRSPKDGERYFALLKVS 120

Query: 121 AINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIV 180
            INF+ PE+ ++K HFDNLTPLYP K   +E+ +P  KD SSRVID+++P+GKGQR+LIV
Sbjct: 121 NINFEDPEKAKHKSHFDNLTPLYPTKWLKLEIEDPTIKDFSSRVIDIVSPLGKGQRALIV 180

Query: 181 APPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAA 240
           APPRTGKT+LLQNIAHSI  NHPECYLIVLLIDERPEEVTDMQR+V+GEVISSTFDE  +
Sbjct: 181 APPRTGKTVLLQNIAHSITANHPECYLIVLLIDERPEEVTDMQRNVKGEVISSTFDEPPS 240

Query: 241 RHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRP 300
           RHVQV+EMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVD+NALQRP
Sbjct: 241 RHVQVSEMVIEKAKRLVEHKRDVVILLDSITRLGRAYNTVVPSSGKVLTGGVDSNALQRP 300

Query: 301 KRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPA 360
           KRFFGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEI+L+RK++DKR+FPA
Sbjct: 301 KRFFGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIILDRKVSDKRVFPA 360

Query: 361 MDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           +D+ +SGTRKEDLLV R  L+KV++LRRI++ M + DAIEFLIDKL+ TK N +FF SMN
Sbjct: 361 IDVARSGTRKEDLLVPRDQLKKVYVLRRILNPMGTMDAIEFLIDKLRSTKTNGEFFQSMN 420


>gi|146278701|ref|YP_001168860.1| transcription termination factor Rho [Rhodobacter sphaeroides ATCC
           17025]
 gi|145556942|gb|ABP71555.1| transcription termination factor Rho [Rhodobacter sphaeroides ATCC
           17025]
          Length = 422

 Score =  654 bits (1686), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/421 (75%), Positives = 364/421 (86%), Gaps = 1/421 (0%)

Query: 1   MSE-MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIE 59
           M+E + L +LK K+P  LLA AE  EIENA  MRK E+MFSILK  +    E+ G+GV+E
Sbjct: 1   MTERLNLADLKAKTPADLLAMAEEWEIENAPSMRKGEMMFSILKEHAEEGYEVGGDGVLE 60

Query: 60  VLQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKV 119
           VLQDGFGFLRSP+ANYL GPDDIYVSP  ++ FSL+TGDTVEG I APRE ERYF+L +V
Sbjct: 61  VLQDGFGFLRSPEANYLPGPDDIYVSPEILRQFSLRTGDTVEGVIVAPRENERYFSLTRV 120

Query: 120 NAINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLI 179
             INFD PER R+K+HFDNLTPLYPD+R  ME+++P  KD S+R+IDL+APIGKGQR LI
Sbjct: 121 TRINFDDPERARHKVHFDNLTPLYPDERLKMEVDDPTVKDRSARIIDLVAPIGKGQRGLI 180

Query: 180 VAPPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESA 239
           VAPPRTGKT+LLQNIAHSI  NHPECYLIVLLIDERPEEVTDMQRSV+GEV+SSTFDE A
Sbjct: 181 VAPPRTGKTVLLQNIAHSIATNHPECYLIVLLIDERPEEVTDMQRSVKGEVVSSTFDEPA 240

Query: 240 ARHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQR 299
            RHV VAEMVI KAK LVE+  DVVILLDSITRL RA+N ++PSSGK+LTGGVDANALQR
Sbjct: 241 TRHVAVAEMVIEKAKRLVEHKRDVVILLDSITRLGRAFNTVVPSSGKVLTGGVDANALQR 300

Query: 300 PKRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFP 359
           PKRFFGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RK+ADKR+FP
Sbjct: 301 PKRFFGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKVADKRVFP 360

Query: 360 AMDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSM 419
           AMDI+KSGTRKEDLLV++ DLQK ++LRRI++ M ++DAIEFLI KL+QTK N +FF SM
Sbjct: 361 AMDILKSGTRKEDLLVDKSDLQKTYVLRRILNPMGTTDAIEFLISKLRQTKSNAEFFDSM 420

Query: 420 N 420
           N
Sbjct: 421 N 421


>gi|77464809|ref|YP_354313.1| transcription termination factor Rho [Rhodobacter sphaeroides
           2.4.1]
 gi|126463652|ref|YP_001044766.1| transcription termination factor Rho [Rhodobacter sphaeroides ATCC
           17029]
 gi|221640728|ref|YP_002526990.1| transcription termination factor Rho [Rhodobacter sphaeroides
           KD131]
 gi|1710266|sp|P52156|RHO_RHOS4 RecName: Full=Transcription termination factor Rho; AltName:
           Full=ATP-dependent helicase Rho
 gi|1162971|gb|AAB02034.1| rho [Rhodobacter sphaeroides]
 gi|77389227|gb|ABA80412.1| transcription termination factor Rho [Rhodobacter sphaeroides
           2.4.1]
 gi|126105316|gb|ABN77994.1| transcription termination factor Rho [Rhodobacter sphaeroides ATCC
           17029]
 gi|221161509|gb|ACM02489.1| Transcription termination factor rho [Rhodobacter sphaeroides
           KD131]
          Length = 422

 Score =  654 bits (1686), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/417 (75%), Positives = 361/417 (86%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           + L +LK K+P  LLA AE  EIENA  MRK E+MFSILK  +    E+ G+GV+EVLQD
Sbjct: 5   LNLADLKAKTPADLLAMAEEWEIENAPSMRKGEMMFSILKEHAEEGYEVGGDGVLEVLQD 64

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSP+ANYL GPDDIYVSP  ++ FSL+TGDT+EG I APRE ERYF+L +V  IN
Sbjct: 65  GFGFLRSPEANYLPGPDDIYVSPEILRQFSLRTGDTIEGVIVAPRENERYFSLTRVTKIN 124

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           FD PER R+K+HFDNLTPLYPD+R  ME+++P  KD S+R+IDL+APIGKGQR LIVAPP
Sbjct: 125 FDDPERARHKVHFDNLTPLYPDERLKMEVDDPTMKDRSARIIDLVAPIGKGQRGLIVAPP 184

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           RTGKT+LLQNIAHSI  NHPECYLIVLLIDERPEEVTDMQRSV+GEV+SSTFDE A RHV
Sbjct: 185 RTGKTVLLQNIAHSIATNHPECYLIVLLIDERPEEVTDMQRSVKGEVVSSTFDEPATRHV 244

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
            VAEMVI KAK LVE+  DVVILLDSITRL RA+N ++PSSGK+LTGGVDANALQRPKRF
Sbjct: 245 AVAEMVIEKAKRLVEHKRDVVILLDSITRLGRAFNTVVPSSGKVLTGGVDANALQRPKRF 304

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RK+ADKR+FPAMDI
Sbjct: 305 FGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKVADKRVFPAMDI 364

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           +KSGTRKEDLLV++ DLQK ++LRRI++ M ++DAIEFLI KL+QTK N +FF SMN
Sbjct: 365 LKSGTRKEDLLVDKSDLQKTYVLRRILNPMGTTDAIEFLISKLRQTKSNAEFFDSMN 421


>gi|260576108|ref|ZP_05844101.1| transcription termination factor Rho [Rhodobacter sp. SW2]
 gi|259021588|gb|EEW24891.1| transcription termination factor Rho [Rhodobacter sp. SW2]
          Length = 423

 Score =  653 bits (1685), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/420 (74%), Positives = 361/420 (85%)

Query: 1   MSEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEV 60
           ++ + L ELK K+P  LLA AE  EIENA  MRK E+MFSILK  +    EI G+GV+EV
Sbjct: 3   LNRLNLAELKAKTPADLLAMAEEWEIENAPSMRKGEMMFSILKEHAEEGWEIGGDGVLEV 62

Query: 61  LQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVN 120
           LQDGFGFLRSP ANYL GPDDIYVSP  ++ FSL+TGDT+EG ++APRE ERYF L K  
Sbjct: 63  LQDGFGFLRSPSANYLPGPDDIYVSPEILRQFSLRTGDTIEGVMQAPRENERYFCLTKAT 122

Query: 121 AINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIV 180
            INFD PE+ R+K+HFDNLTPLYPD+RF ME+++P  KD S RVIDL+APIGKGQR LIV
Sbjct: 123 RINFDDPEKARHKVHFDNLTPLYPDERFKMEVDDPTLKDRSGRVIDLVAPIGKGQRGLIV 182

Query: 181 APPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAA 240
           APPRTGKT+LLQNIAHSI  NHP+CYLIVLLIDERPEEVTDMQRSV+GEV+SSTFDE A 
Sbjct: 183 APPRTGKTVLLQNIAHSIATNHPDCYLIVLLIDERPEEVTDMQRSVKGEVVSSTFDEPAT 242

Query: 241 RHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRP 300
           RHV VAEMVI KAK LVE+  DVVILLDSITRL RA+N ++PSSGK+LTGGVDANALQRP
Sbjct: 243 RHVAVAEMVIEKAKRLVEHKRDVVILLDSITRLGRAFNTVVPSSGKVLTGGVDANALQRP 302

Query: 301 KRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPA 360
           KRFFGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RK+ADKR+FPA
Sbjct: 303 KRFFGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKVADKRVFPA 362

Query: 361 MDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           MDI+KSGTRKEDLLVE+ DLQK ++LRRI++ M ++DAIEFL+ K+KQTK N +FF SMN
Sbjct: 363 MDILKSGTRKEDLLVEKADLQKTYVLRRILNPMGTTDAIEFLLAKMKQTKSNAEFFDSMN 422


>gi|332559705|ref|ZP_08414027.1| transcription termination factor Rho [Rhodobacter sphaeroides WS8N]
 gi|332277417|gb|EGJ22732.1| transcription termination factor Rho [Rhodobacter sphaeroides WS8N]
          Length = 422

 Score =  653 bits (1685), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/417 (75%), Positives = 361/417 (86%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           + L +LK K+P  LLA AE  EIENA  MRK E+MFSILK  +    E+ G+GV+EVLQD
Sbjct: 5   LNLADLKAKTPADLLAMAEEWEIENAPSMRKGEMMFSILKEHAEEGYEVGGDGVLEVLQD 64

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSP+ANYL GPDDIYVSP  ++ FSL+TGDT+EG I APRE ERYF+L +V  IN
Sbjct: 65  GFGFLRSPEANYLPGPDDIYVSPEILRQFSLRTGDTIEGVIVAPRENERYFSLTRVTKIN 124

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           FD PER R+K+HFDNLTPLYPD+R  ME+++P  KD S+R+IDL+APIGKGQR LIVAPP
Sbjct: 125 FDDPERARHKVHFDNLTPLYPDERLKMEVDDPTVKDRSARIIDLVAPIGKGQRGLIVAPP 184

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           RTGKT+LLQNIAHSI  NHPECYLIVLLIDERPEEVTDMQRSV+GEV+SSTFDE A RHV
Sbjct: 185 RTGKTVLLQNIAHSIATNHPECYLIVLLIDERPEEVTDMQRSVKGEVVSSTFDEPATRHV 244

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
            VAEMVI KAK LVE+  DVVILLDSITRL RA+N ++PSSGK+LTGGVDANALQRPKRF
Sbjct: 245 AVAEMVIEKAKRLVEHKRDVVILLDSITRLGRAFNTVVPSSGKVLTGGVDANALQRPKRF 304

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RK+ADKR+FPAMDI
Sbjct: 305 FGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKVADKRVFPAMDI 364

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           +KSGTRKEDLLV++ DLQK ++LRRI++ M ++DAIEFLI KL+QTK N +FF SMN
Sbjct: 365 LKSGTRKEDLLVDKSDLQKTYVLRRILNPMGTTDAIEFLISKLRQTKSNAEFFDSMN 421


>gi|294675622|ref|YP_003576237.1| transcription termination factor Rho [Rhodobacter capsulatus SB
           1003]
 gi|294474442|gb|ADE83830.1| transcription termination factor Rho [Rhodobacter capsulatus SB
           1003]
          Length = 422

 Score =  653 bits (1684), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/421 (75%), Positives = 365/421 (86%), Gaps = 1/421 (0%)

Query: 1   MSE-MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIE 59
           M+E + L +LK KSP  LLA AE  EIENA+ MRK E+MFSILK  +   VEI G+GV+E
Sbjct: 1   MTERLNLSDLKAKSPKDLLAMAEDWEIENASTMRKGEMMFSILKEHAEEGVEIGGDGVLE 60

Query: 60  VLQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKV 119
           VLQDGFGFLRSP+ANYL GPDDIYVSP  I+ +SL+TGDTV G IRAP E ERYFAL  V
Sbjct: 61  VLQDGFGFLRSPEANYLPGPDDIYVSPEMIRQYSLRTGDTVWGIIRAPGENERYFALTAV 120

Query: 120 NAINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLI 179
             INF+ PE+ R+K+ FDNLTPLYPD+R  ME+ +P  KD S+R+IDL+APIGKGQRSLI
Sbjct: 121 EKINFEDPEKARHKVSFDNLTPLYPDERLKMEIEDPTIKDRSARIIDLVAPIGKGQRSLI 180

Query: 180 VAPPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESA 239
           VAPPRTGKT+LLQNIAHSI+ NHPECYLIVLLIDERPEEVTDMQRSV+GEVISSTFDE A
Sbjct: 181 VAPPRTGKTVLLQNIAHSIEVNHPECYLIVLLIDERPEEVTDMQRSVKGEVISSTFDEPA 240

Query: 240 ARHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQR 299
            RHV VAEMVI KAK LVE+  DVVILLDSITRL RA+N ++PSSGK+LTGGVDANALQR
Sbjct: 241 TRHVAVAEMVIEKAKRLVEHKRDVVILLDSITRLGRAFNTVVPSSGKVLTGGVDANALQR 300

Query: 300 PKRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFP 359
           PKRFFGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RK+ADKR+FP
Sbjct: 301 PKRFFGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKVADKRVFP 360

Query: 360 AMDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSM 419
           AMDI+KSGTRKEDLLV+++DLQK ++LRRI++ M ++DAIEFLI KLKQTK N +FF SM
Sbjct: 361 AMDILKSGTRKEDLLVDQKDLQKTYLLRRILNPMGTTDAIEFLISKLKQTKTNGEFFDSM 420

Query: 420 N 420
           N
Sbjct: 421 N 421


>gi|260429622|ref|ZP_05783599.1| transcription termination factor Rho [Citreicella sp. SE45]
 gi|260420245|gb|EEX13498.1| transcription termination factor Rho [Citreicella sp. SE45]
          Length = 423

 Score =  652 bits (1682), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/422 (75%), Positives = 365/422 (86%), Gaps = 2/422 (0%)

Query: 1   MSEMKLQ--ELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVI 58
           MSE KL   +LK KSP  LL+ AE LEIENA+ MRK E+MF IL+  +  D +I G+GV+
Sbjct: 1   MSEEKLNLADLKAKSPKDLLSMAEELEIENASTMRKGEMMFQILRERADEDWQIFGDGVL 60

Query: 59  EVLQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLK 118
           EVLQDGFGFLRSP+ANYL GPDDIYVSP  I+ +SL+TGDTVEG IRAP   ERYFAL+ 
Sbjct: 61  EVLQDGFGFLRSPEANYLPGPDDIYVSPEMIRKYSLRTGDTVEGEIRAPDGEERYFALVD 120

Query: 119 VNAINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSL 178
           V  INF+ P+R R+KI FDNLTPLYPD+R  ME+ +P  KD S+R+IDL+APIGKGQRSL
Sbjct: 121 VTKINFEDPDRARHKIAFDNLTPLYPDERLKMEIEDPTIKDRSARIIDLVAPIGKGQRSL 180

Query: 179 IVAPPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDES 238
           IVAPPRTGKT+LLQNIA SI+KNHPECYLIVLLIDERPEEVTDMQRSV+GEVISSTFDE 
Sbjct: 181 IVAPPRTGKTVLLQNIAASIEKNHPECYLIVLLIDERPEEVTDMQRSVKGEVISSTFDEP 240

Query: 239 AARHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQ 298
           A RHV V+EMVI KAK LVE+  DVVILLDSITRL RA+N ++PSSGK+LTGGVDANALQ
Sbjct: 241 ATRHVAVSEMVIEKAKRLVEHKRDVVILLDSITRLGRAFNTVVPSSGKVLTGGVDANALQ 300

Query: 299 RPKRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIF 358
           RPKRFFGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RK+ADKR+F
Sbjct: 301 RPKRFFGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKVADKRVF 360

Query: 359 PAMDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYS 418
           PAMDI+KSGTRKEDLLV++ DLQK F+LRRI++ M ++DAIEFLI KLKQTK N +FF S
Sbjct: 361 PAMDILKSGTRKEDLLVDKTDLQKTFVLRRILNPMGTTDAIEFLISKLKQTKTNSEFFDS 420

Query: 419 MN 420
           MN
Sbjct: 421 MN 422


>gi|21328729|gb|AAM48735.1| transcription termination factor Rho [uncultured marine
           proteobacterium]
          Length = 418

 Score =  652 bits (1682), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/417 (75%), Positives = 363/417 (87%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK KSP  LL+ AE LEIENA+ MRK ++MFSILK  +    EI G+GV+EVLQD
Sbjct: 1   MTLAELKAKSPKDLLSMAEELEIENASTMRKGDMMFSILKERAEDGAEISGDGVLEVLQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSP+ANYL GPDDIYVSP  I+ FSL+TGDT+EG I+AP + ERYF + KV  IN
Sbjct: 61  GFGFLRSPEANYLPGPDDIYVSPEMIRQFSLRTGDTIEGIIKAPEDTERYFGMTKVEKIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           F+ PER R+K+ F+NLTPLYPD+R  MEL +P  KD S+R+IDL+APIGKGQRSLIVAPP
Sbjct: 121 FENPERARHKVAFENLTPLYPDERLKMELEDPTTKDRSARIIDLVAPIGKGQRSLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           RTGKT+LLQNIA+SI+KNHPECYLIVLLIDERPEEVTDMQRSV+GEV+SSTFDE A RHV
Sbjct: 181 RTGKTVLLQNIANSIEKNHPECYLIVLLIDERPEEVTDMQRSVKGEVVSSTFDEPATRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
            V+EMVI KAK LVE+  DVVILLDSITRL RA+N ++PSSGK+LTGGVDANALQRPKRF
Sbjct: 241 AVSEMVIEKAKRLVEHKRDVVILLDSITRLGRAFNTVVPSSGKVLTGGVDANALQRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RK+ADKR+FPAMD+
Sbjct: 301 FGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKVADKRVFPAMDV 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           +KSGTRKEDLLV++ DLQK ++LRRI++ M ++DAIEFLI KLKQTK N +FF SMN
Sbjct: 361 LKSGTRKEDLLVDKVDLQKTYVLRRILNPMGTTDAIEFLISKLKQTKSNSEFFDSMN 417


>gi|119382759|ref|YP_913815.1| transcription termination factor Rho [Paracoccus denitrificans
           PD1222]
 gi|119372526|gb|ABL68119.1| transcription termination factor Rho [Paracoccus denitrificans
           PD1222]
          Length = 434

 Score =  650 bits (1678), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/417 (75%), Positives = 363/417 (87%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           + L +LK KSP  LLA AE  EIENA+ MRK E+MFSILK  +    EI G+GV+EV+QD
Sbjct: 17  LNLSDLKAKSPADLLAMAEEWEIENASTMRKGEMMFSILKEHAEEGFEIGGDGVLEVVQD 76

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSP+ANYL GPDDIYVSP  I+  SL+TGDTVEG IRAP E ERYFAL KV  IN
Sbjct: 77  GFGFLRSPEANYLPGPDDIYVSPDMIRQHSLRTGDTVEGVIRAPGENERYFALTKVEKIN 136

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           F+ PE+ R+K+ FDNLTPLYP++R  ME+ +P  KD S+R+IDL+APIGKGQRSLIVAPP
Sbjct: 137 FENPEKARHKVAFDNLTPLYPNERLKMEIEDPTIKDRSARIIDLVAPIGKGQRSLIVAPP 196

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           RTGKT+LLQNIAHSI+KNHPECYLIVLLIDERPEEVTDMQRSV+GEVISSTFDE A+RHV
Sbjct: 197 RTGKTVLLQNIAHSIEKNHPECYLIVLLIDERPEEVTDMQRSVKGEVISSTFDEPASRHV 256

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
            V+EMVI KAK LVE+  DVVILLDSITRL RA+N ++PSSGK+LTGGVDANALQRPKRF
Sbjct: 257 AVSEMVIEKAKRLVEHKRDVVILLDSITRLGRAFNTVVPSSGKVLTGGVDANALQRPKRF 316

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RK+ADKR+FPAMDI
Sbjct: 317 FGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKVADKRVFPAMDI 376

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           +KSGTRKE+LLV+ +DLQK ++LRRI++ M ++DAIEFLI KLKQTK N +FF SMN
Sbjct: 377 LKSGTRKEELLVDAKDLQKTYLLRRILNPMGTTDAIEFLISKLKQTKTNGEFFDSMN 433


>gi|259417327|ref|ZP_05741246.1| transcription termination factor Rho [Silicibacter sp. TrichCH4B]
 gi|259346233|gb|EEW58047.1| transcription termination factor Rho [Silicibacter sp. TrichCH4B]
          Length = 423

 Score =  650 bits (1677), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/417 (75%), Positives = 362/417 (86%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           + L +LK +SP  LLA AE LEIENA+ MRK E+MF IL+  +     I G+GV+EVLQD
Sbjct: 6   LNLSDLKAQSPKALLAMAEELEIENASTMRKGEMMFQILRERADEGWNIGGDGVLEVLQD 65

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSP+ANYL GPDDIYVSP  I+ FSL+TGDTVEG I+AP E ERYFAL  V  IN
Sbjct: 66  GFGFLRSPEANYLPGPDDIYVSPDMIRQFSLRTGDTVEGQIKAPLENERYFALTTVTKIN 125

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           F+ PE+ R+KI FDNLTPLYPD+R NME+ +P  KD S+RVIDL++PIGKGQRSLIVAPP
Sbjct: 126 FEEPEKARHKIAFDNLTPLYPDERLNMEIEDPTVKDRSARVIDLVSPIGKGQRSLIVAPP 185

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           RTGKT+LLQNIAHSI++NHPECYLIVLLIDERPEEVTDMQRSV+GEV+SSTFDE AARHV
Sbjct: 186 RTGKTVLLQNIAHSIEQNHPECYLIVLLIDERPEEVTDMQRSVKGEVVSSTFDEPAARHV 245

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
            V+EMVI KAK LVE+  DVVILLDSITRL RA+N ++PSSGK+LTGGVDANALQRPKRF
Sbjct: 246 AVSEMVIEKAKRLVEHKRDVVILLDSITRLGRAFNTVVPSSGKVLTGGVDANALQRPKRF 305

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RKIADKR+FPA+DI
Sbjct: 306 FGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKIADKRVFPAIDI 365

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           +KSGTRKEDLLV++ DL K F+LRRI++ M ++DAIEFL+ KLKQTK N +FF SMN
Sbjct: 366 LKSGTRKEDLLVDKGDLAKTFVLRRILNPMGTTDAIEFLLSKLKQTKTNSEFFDSMN 422


>gi|209966063|ref|YP_002298978.1| transcription termination factor Rho [Rhodospirillum centenum SW]
 gi|209959529|gb|ACJ00166.1| transcription termination factor Rho [Rhodospirillum centenum SW]
          Length = 422

 Score =  650 bits (1677), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/422 (73%), Positives = 369/422 (87%), Gaps = 4/422 (0%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M LQ+LK K+P +LLAFAE L+IENA  +RKQ++MF+ILK L+  DV I GEGV+EVL D
Sbjct: 1   MNLQDLKAKTPAELLAFAEELQIENAGTLRKQDMMFAILKQLAENDVPIYGEGVLEVLSD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSP+ANYL GPDDIYVSPSQ++ F L+TGDTVEG IR+P+EGERYFALLKVN+IN
Sbjct: 61  GFGFLRSPEANYLPGPDDIYVSPSQVRRFGLRTGDTVEGQIRSPKEGERYFALLKVNSIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMEL----NNPENKDISSRVIDLIAPIGKGQRSLI 179
           FD P++VR++I+FDNLTPLYPD R  +E+    +    KD+++RVIDL+AP+GKGQR+LI
Sbjct: 121 FDHPDKVRHRINFDNLTPLYPDDRLRLEIEVDSSGKSKKDMTTRVIDLVAPLGKGQRALI 180

Query: 180 VAPPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESA 239
           VAPPRTGKT++LQNIAHSI  NHPE YLIVLLIDERPEEVTDM RSV+GEVISSTFDE A
Sbjct: 181 VAPPRTGKTVMLQNIAHSIATNHPEVYLIVLLIDERPEEVTDMARSVRGEVISSTFDEPA 240

Query: 240 ARHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQR 299
            RHVQV EMV+ KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQR
Sbjct: 241 TRHVQVTEMVLEKAKRLVEHKRDVVILLDSITRLGRAYNTVVPSSGKVLTGGVDANALQR 300

Query: 300 PKRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFP 359
           PKRFFGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEI+L+RK++DKR+FP
Sbjct: 301 PKRFFGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIILDRKLSDKRVFP 360

Query: 360 AMDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSM 419
           A+DI KSGTRKE+LLV++  + K+++LRRI++ M + DA+EFLIDKLKQ K N DFF SM
Sbjct: 361 AIDIQKSGTRKEELLVDKGAMAKMWILRRILNPMGTQDAVEFLIDKLKQAKTNNDFFDSM 420

Query: 420 NK 421
           N+
Sbjct: 421 NQ 422


>gi|260431963|ref|ZP_05785934.1| transcription termination factor Rho [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260415791|gb|EEX09050.1| transcription termination factor Rho [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 427

 Score =  650 bits (1676), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/417 (74%), Positives = 363/417 (87%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           + L +LK KSP  LLA AE LEIENA+ MRK E+MF IL+  +     + G+GV+EVLQD
Sbjct: 10  LNLADLKAKSPKDLLAMAEELEIENASTMRKGEMMFQILRERADEGWTVGGDGVLEVLQD 69

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSP+ANYL GPDDIYVSP  I+ +SL+TGDTVEG I+AP E ERYFAL KV  IN
Sbjct: 70  GFGFLRSPEANYLPGPDDIYVSPEMIRQYSLRTGDTVEGEIKAPEETERYFALTKVTKIN 129

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           F+ PE+ ++KI FDNLTPLYPD+R  ME+ +P  KD S+RVIDL+APIGKGQRSLIVAPP
Sbjct: 130 FEDPEKAKHKIAFDNLTPLYPDERLKMEIEDPTIKDKSARVIDLVAPIGKGQRSLIVAPP 189

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           RTGKT++LQNIAHSI++NHPECYLIVLLIDERPEEVTDMQRSV+GEV+SSTFDE A+RHV
Sbjct: 190 RTGKTVILQNIAHSIERNHPECYLIVLLIDERPEEVTDMQRSVKGEVVSSTFDEPASRHV 249

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
            V+EMVI KAK LVE+  DVVILLDSITRL RA+N ++PSSGK+LTGGVDANALQRPKRF
Sbjct: 250 AVSEMVIEKAKRLVEHKRDVVILLDSITRLGRAFNTVVPSSGKVLTGGVDANALQRPKRF 309

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RKIADKR+FPA+DI
Sbjct: 310 FGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKIADKRVFPAIDI 369

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           +KSGTRKEDLLV++ DLQK F+LRRI++ M ++DAIEFL+ KLKQTK N +FF SMN
Sbjct: 370 LKSGTRKEDLLVDKGDLQKTFVLRRILNPMGTTDAIEFLLSKLKQTKTNAEFFDSMN 426


>gi|144899668|emb|CAM76532.1| transcription termination factor [Magnetospirillum gryphiswaldense
           MSR-1]
          Length = 428

 Score =  650 bits (1676), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/417 (72%), Positives = 368/417 (88%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK K+P +LLA+AE L+IENA+ +RKQ++MF+ILK L+  D  I GEGV+EVLQD
Sbjct: 11  MHLSELKKKTPAELLAYAEELQIENASTLRKQDMMFAILKQLADNDTPIYGEGVLEVLQD 70

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSP+ANYL GPDDIYVSPSQ++ F L+TGDTVEG IR+P++GERYFALLKVN IN
Sbjct: 71  GFGFLRSPEANYLPGPDDIYVSPSQVRRFGLRTGDTVEGQIRSPKDGERYFALLKVNTIN 130

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           F+ PE VR++I+FDNLTPLYP+++  +E+++P  KD+++RVIDLIAP+GKGQR+LIVAPP
Sbjct: 131 FEPPENVRHRINFDNLTPLYPNEKLRLEVDDPTKKDLTTRVIDLIAPVGKGQRALIVAPP 190

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           RTGKT++LQN+AH+I  NHPE YLIVLLIDERPEEVTDM RSV+GEVISSTFDE A RHV
Sbjct: 191 RTGKTVMLQNMAHAISANHPEVYLIVLLIDERPEEVTDMARSVKGEVISSTFDEPAVRHV 250

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QV EMV+ KAK LVE+  DVVILLDS+TRL RAYN ++PSSGK+LTGGVDANALQRPKRF
Sbjct: 251 QVTEMVLEKAKRLVEHKRDVVILLDSVTRLARAYNTVVPSSGKVLTGGVDANALQRPKRF 310

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSL+II TAL+DTGSRMDEVIFEEFKGTGNSEI+L+RK++DKR FPA+DI
Sbjct: 311 FGAARNIEEGGSLSIIATALIDTGSRMDEVIFEEFKGTGNSEIILDRKLSDKRTFPAIDI 370

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
            KSGTRKE+LLV++  L K+++LRRI+  M  SDA+EFL+DKLK +K+N DFF +MN
Sbjct: 371 TKSGTRKEELLVDKGQLSKMWVLRRILMPMGVSDAMEFLVDKLKHSKNNADFFDAMN 427


>gi|149204378|ref|ZP_01881345.1| transcription termination factor Rho [Roseovarius sp. TM1035]
 gi|149142263|gb|EDM30310.1| transcription termination factor Rho [Roseovarius sp. TM1035]
          Length = 418

 Score =  650 bits (1676), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/417 (74%), Positives = 361/417 (86%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L +LK  S  +LL  AE LEIENA+ MRK E+MFSILK  +  D  + G+GV+EVLQD
Sbjct: 1   MNLSDLKALSAKELLTIAEELEIENASTMRKGEMMFSILKERAEEDWTVYGDGVLEVLQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSP+ANYL GPDDIYVSP  I+ +SL+TGDT+EG ++ P E ERYFAL  V  IN
Sbjct: 61  GFGFLRSPEANYLPGPDDIYVSPDMIRQYSLRTGDTIEGQMKQPDETERYFALTSVTQIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           F+ PER R+KI FDNLTPLYPD+RF ME+ +P  KD S+R+IDL+APIGKGQRSLIVAPP
Sbjct: 121 FEDPERARHKIAFDNLTPLYPDERFKMEIEDPTIKDRSARIIDLVAPIGKGQRSLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           RTGKT+LLQNIAHSI+KNHPECYLIVLLIDERPEEVTDMQRSV+GEV+SSTFDE A RHV
Sbjct: 181 RTGKTVLLQNIAHSIEKNHPECYLIVLLIDERPEEVTDMQRSVKGEVVSSTFDEPATRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
            V+EMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRPKRF
Sbjct: 241 AVSEMVIEKAKRLVEHKRDVVILLDSITRLGRAYNTVVPSSGKVLTGGVDANALQRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RK+ADKR+FPA+DI
Sbjct: 301 FGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKVADKRVFPAIDI 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           +KSGTRKEDLL+++ DLQK F+LRRI++ M ++DA+EFL+ KLKQTK N +FF SMN
Sbjct: 361 LKSGTRKEDLLIDKGDLQKTFVLRRILNPMGTTDAVEFLLSKLKQTKTNSEFFDSMN 417


>gi|304320454|ref|YP_003854097.1| transcription termination factor Rho [Parvularcula bermudensis
           HTCC2503]
 gi|303299356|gb|ADM08955.1| transcription termination factor Rho [Parvularcula bermudensis
           HTCC2503]
          Length = 439

 Score =  649 bits (1675), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/434 (70%), Positives = 371/434 (85%), Gaps = 16/434 (3%)

Query: 3   EMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQ 62
           ++ L E+K KSP  L++FAE + +ENA+ +RKQ+L+F+ILK L+  DVEIIG GV+E+L 
Sbjct: 5   QITLDEIKEKSPQDLVSFAEEVGVENASALRKQDLLFAILKELADEDVEIIGSGVLEILA 64

Query: 63  DGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAI 122
           DGFGFLRS DANYLAGPDDIY SP QI+ F+LKTGDTV G IR+P++GERYFAL KVN +
Sbjct: 65  DGFGFLRSADANYLAGPDDIYCSPQQIRKFTLKTGDTVTGEIRSPKDGERYFALTKVNTV 124

Query: 123 NFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPE----------------NKDISSRVID 166
           NF+ PE+ R+K+HFDNLTPLYP++R  ME+   E                 +D+S+RVID
Sbjct: 125 NFETPEKARHKVHFDNLTPLYPEERLKMEVVTDEEPGSRGPNGRLKKGESGRDLSTRVID 184

Query: 167 LIAPIGKGQRSLIVAPPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSV 226
           ++AP+GKGQR+LIVAPPRTGKT+LLQNIAH+I  NHPECYLIVLLIDERPEEVTDMQRSV
Sbjct: 185 IVAPLGKGQRALIVAPPRTGKTVLLQNIAHAITSNHPECYLIVLLIDERPEEVTDMQRSV 244

Query: 227 QGEVISSTFDESAARHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGK 286
           +GEV+SSTFDE A+RHV V+EMVI KAK LVE+G DVVILLDSITRL RAYN ++PSSGK
Sbjct: 245 KGEVVSSTFDEPASRHVAVSEMVIEKAKRLVEHGRDVVILLDSITRLGRAYNTVVPSSGK 304

Query: 287 ILTGGVDANALQRPKRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEI 346
           +LTGGVDANALQRPKRFFGAARNI+EGGSLTII TAL+DTGSRMDEV+FEEFKGTGNSEI
Sbjct: 305 VLTGGVDANALQRPKRFFGAARNIEEGGSLTIIATALIDTGSRMDEVVFEEFKGTGNSEI 364

Query: 347 VLERKIADKRIFPAMDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKL 406
           VL+RK+ADKR+FPA+D+ KSGTRKEDLL+E+ +L K+F+LRRI+S MN+ D+IEFL++KL
Sbjct: 365 VLDRKVADKRVFPAIDVAKSGTRKEDLLIEKGELAKIFVLRRILSPMNAMDSIEFLLEKL 424

Query: 407 KQTKDNKDFFYSMN 420
           +Q K N+DFF SMN
Sbjct: 425 RQVKSNQDFFDSMN 438


>gi|126738506|ref|ZP_01754211.1| transcription termination factor Rho [Roseobacter sp. SK209-2-6]
 gi|126720305|gb|EBA17011.1| transcription termination factor Rho [Roseobacter sp. SK209-2-6]
          Length = 423

 Score =  649 bits (1673), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/417 (75%), Positives = 361/417 (86%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           + L +LK KSP  LLA AE LEIENA+ MRK E+MF IL+  +    EI G+GV+EVLQD
Sbjct: 6   LNLSDLKAKSPKALLAMAEELEIENASTMRKGEMMFQILRERADEGWEIGGDGVLEVLQD 65

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSP+ANYL GPDDIYVSP  I+ FSL+TGDT+EG I+AP + ERYFA+  V  IN
Sbjct: 66  GFGFLRSPEANYLPGPDDIYVSPDMIRKFSLRTGDTIEGQIKAPLDSERYFAMTSVTKIN 125

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           F+ PE+ R+KI FDNLTPLYPD+R  ME+ +P  KD S+RVIDL+APIGKGQRSLIVAPP
Sbjct: 126 FEEPEKARHKIAFDNLTPLYPDERLKMEIEDPTIKDRSARVIDLVAPIGKGQRSLIVAPP 185

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           RTGKT++LQNIAHSI+KNHPECYLIVLLIDERPEEVTDMQRSV+GEV+SSTFDE A RHV
Sbjct: 186 RTGKTVILQNIAHSIEKNHPECYLIVLLIDERPEEVTDMQRSVKGEVVSSTFDEPATRHV 245

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
            V+EMVI KAK LVE+  DVVILLDSITRL RA+N ++PSSGK+LTGGVDANALQRPKRF
Sbjct: 246 AVSEMVIEKAKRLVEHKRDVVILLDSITRLGRAFNTVVPSSGKVLTGGVDANALQRPKRF 305

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RKIADKR+FPA+DI
Sbjct: 306 FGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKIADKRVFPAIDI 365

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           +KSGTRKEDLLV++ DL K F+LRRI++ M ++DAIEFL+ KLKQTK N DFF SMN
Sbjct: 366 LKSGTRKEDLLVDKGDLAKTFVLRRILNPMGTTDAIEFLLGKLKQTKSNSDFFDSMN 422


>gi|83950776|ref|ZP_00959509.1| transcription termination factor Rho [Roseovarius nubinhibens ISM]
 gi|83838675|gb|EAP77971.1| transcription termination factor Rho [Roseovarius nubinhibens ISM]
          Length = 418

 Score =  648 bits (1671), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/417 (75%), Positives = 362/417 (86%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L +LK +S   LLA AE LEIENA+ MRK E+MFSILK  +     + G+GV+EVLQD
Sbjct: 1   MNLSDLKAQSAKDLLAMAEELEIENASTMRKGEMMFSILKERAEEGWVVYGDGVLEVLQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSP+ANYL+GPDDIYVSP  I+ +SL+TGDTVEG I+ P E ERYFAL  V+ IN
Sbjct: 61  GFGFLRSPEANYLSGPDDIYVSPETIRQYSLRTGDTVEGEIKQPEENERYFALTSVSQIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           F+ PE+ R+KI FDNLTPLYPD+R  ME+ +P  KD S+R+IDL+APIGKGQRSLIVAPP
Sbjct: 121 FEDPEKARHKIAFDNLTPLYPDERLTMEVEDPTVKDRSARIIDLVAPIGKGQRSLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           RTGKT+LLQNIA SI+KNHPECYLIVLLIDERPEEVTDMQRSV+GEVISSTFDE AARHV
Sbjct: 181 RTGKTVLLQNIAASIEKNHPECYLIVLLIDERPEEVTDMQRSVKGEVISSTFDEPAARHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
            V+EMVI KAK LVE+  DVVILLDSITRL RA+N ++PSSGK+LTGGVDANALQRPKRF
Sbjct: 241 AVSEMVIEKAKRLVEHKRDVVILLDSITRLGRAFNTVVPSSGKVLTGGVDANALQRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RKIADKR+FPA+DI
Sbjct: 301 FGAARNIEEGGSLTIISTALIDTGSRMDEVIFEEFKGTGNSEIVLDRKIADKRVFPAIDI 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           +KSGTRKEDLLV++ DLQK F+LRRI++ M ++DAIEFLI KLKQTK N +FF SMN
Sbjct: 361 LKSGTRKEDLLVDKIDLQKTFVLRRILNPMGTTDAIEFLISKLKQTKTNSEFFDSMN 417


>gi|99082703|ref|YP_614857.1| transcription termination factor Rho [Ruegeria sp. TM1040]
 gi|99038983|gb|ABF65595.1| transcription termination factor Rho [Ruegeria sp. TM1040]
          Length = 423

 Score =  648 bits (1671), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/417 (75%), Positives = 361/417 (86%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           + L +LK +SP  LLA AE LEIENA+ MRK E+MF IL+  +     I G+GV+EVLQD
Sbjct: 6   LNLSDLKAQSPKALLAMAEELEIENASTMRKGEMMFQILRERADEGWNIGGDGVLEVLQD 65

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSP+ANYL GPDDIYVSP  I+ FSL+TGDTVEG I+AP E ERYFAL  V  IN
Sbjct: 66  GFGFLRSPEANYLPGPDDIYVSPDMIRQFSLRTGDTVEGQIKAPLENERYFALTTVTKIN 125

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           F+ PE+ R+KI FDNLTPLYPD+R  ME+ +P  KD S+RVIDL++PIGKGQRSLIVAPP
Sbjct: 126 FEEPEKARHKIAFDNLTPLYPDERLQMEIEDPTVKDRSARVIDLVSPIGKGQRSLIVAPP 185

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           RTGKT+LLQNIAHSI++NHPECYLIVLLIDERPEEVTDMQRSV+GEV+SSTFDE AARHV
Sbjct: 186 RTGKTVLLQNIAHSIEQNHPECYLIVLLIDERPEEVTDMQRSVKGEVVSSTFDEPAARHV 245

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
            V+EMVI KAK LVE+  DVVILLDSITRL RA+N ++PSSGK+LTGGVDANALQRPKRF
Sbjct: 246 AVSEMVIEKAKRLVEHKRDVVILLDSITRLGRAFNTVVPSSGKVLTGGVDANALQRPKRF 305

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RKIADKR+FPA+DI
Sbjct: 306 FGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKIADKRVFPAIDI 365

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           +KSGTRKEDLLV++ DL K F+LRRI++ M ++DAIEFL+ KLKQTK N +FF SMN
Sbjct: 366 LKSGTRKEDLLVDKGDLAKTFVLRRILNPMGTTDAIEFLLSKLKQTKTNSEFFDSMN 422


>gi|83594948|ref|YP_428700.1| transcription termination factor Rho [Rhodospirillum rubrum ATCC
           11170]
 gi|83577862|gb|ABC24413.1| transcription termination factor Rho [Rhodospirillum rubrum ATCC
           11170]
          Length = 418

 Score =  648 bits (1671), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/417 (72%), Positives = 368/417 (88%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M LQELK+KSP  LLAFAE LEIENA+ +RKQ++MF+ILK L+  D  I GEGV+E+LQD
Sbjct: 1   MHLQELKSKSPADLLAFAEELEIENASNLRKQDMMFAILKQLAENDTAIFGEGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLR+P++NYL GPDDIYVSPSQ++ F L+TGDTVEG IRAP++GERYFALLKVN IN
Sbjct: 61  GFGFLRAPESNYLPGPDDIYVSPSQVRRFGLRTGDTVEGQIRAPKDGERYFALLKVNKIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           F+ PE VR++I+FDNLTPLYPD+R  +E+++P  K+ ++R+IDLI P+GKGQR+LIVAPP
Sbjct: 121 FEAPESVRHRINFDNLTPLYPDERLKLEIDDPTRKEFTTRIIDLITPLGKGQRALIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           RTGKT++LQN+AH+I  N+PE YLIVLLIDERPEEVTDM RSV GEV+SSTFDE A+RHV
Sbjct: 181 RTGKTVMLQNVAHAISANNPEVYLIVLLIDERPEEVTDMARSVNGEVVSSTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKRDVVILLDSITRLARAYNTVVPSSGKVLTGGVDANALQRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEI+L+RK+AD+R+FP++DI
Sbjct: 301 FGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIILDRKLADRRVFPSIDI 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
            +SGTRKE+LLV +  L K+++LRRI+S M   DA+EFL+ K+K+TK+N DFF +MN
Sbjct: 361 ARSGTRKEELLVRKDVLSKMWVLRRILSPMGVQDAMEFLLGKMKETKNNDDFFDAMN 417


>gi|84501197|ref|ZP_00999402.1| transcription termination factor Rho [Oceanicola batsensis
           HTCC2597]
 gi|84390488|gb|EAQ02976.1| transcription termination factor Rho [Oceanicola batsensis
           HTCC2597]
          Length = 423

 Score =  647 bits (1670), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/417 (74%), Positives = 361/417 (86%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           + L +LK KSP  LL+ AE LEIENA+ MRK E+MF IL+  +  D EI G+GV+EVLQD
Sbjct: 6   LNLSDLKAKSPKDLLSMAEELEIENASTMRKGEMMFQILRERADEDWEIGGDGVLEVLQD 65

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSP+ANYL GPDDIYVSP  I+ +SL+TGDTVEG ++ P + ERYFAL  V  IN
Sbjct: 66  GFGFLRSPEANYLPGPDDIYVSPDMIRQYSLRTGDTVEGLMKQPDDNERYFALTSVTKIN 125

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           F+ PE+ R+K+ FDNLTPLYPD+R  ME+ +P  KD S+R+IDL+APIGKGQRSLIVAPP
Sbjct: 126 FEEPEKARHKVSFDNLTPLYPDERLKMEIEDPTIKDRSARIIDLVAPIGKGQRSLIVAPP 185

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           RTGKT+LLQNIAHSI+ NHPECYLIVLLIDERPEEVTDMQRSV+GEVISSTFDE A RHV
Sbjct: 186 RTGKTVLLQNIAHSIETNHPECYLIVLLIDERPEEVTDMQRSVKGEVISSTFDEPATRHV 245

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
            V+EMVI KAK LVE+  DVVILLDSITRL RA+N ++PSSGK+LTGGVDANALQRPKRF
Sbjct: 246 AVSEMVIEKAKRLVEHKRDVVILLDSITRLGRAFNTVVPSSGKVLTGGVDANALQRPKRF 305

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RK+ADKR+FPAMDI
Sbjct: 306 FGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKVADKRVFPAMDI 365

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           +KSGTRKEDLLV++ DLQK F+LRRI++ M ++DAIEFLI KLKQTK N +FF SMN
Sbjct: 366 LKSGTRKEDLLVDKVDLQKTFVLRRILNPMGTTDAIEFLISKLKQTKTNGEFFDSMN 422


>gi|83313652|ref|YP_423916.1| transcription termination factor Rho [Magnetospirillum magneticum
           AMB-1]
 gi|82948493|dbj|BAE53357.1| Transcription termination factor [Magnetospirillum magneticum
           AMB-1]
          Length = 418

 Score =  647 bits (1670), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/417 (72%), Positives = 369/417 (88%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M LQ+LK K+P +LLAFAE LE+ENA+ +RKQ++MF+ILK L+  D  I G+GV+E+LQD
Sbjct: 1   MHLQDLKKKTPAELLAFAEELEVENASTLRKQDMMFAILKQLADNDTPIYGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSP+ANYL GPDDIYVSPSQ++ F L+TGDTV+G IRAP++GERYFALLKVN IN
Sbjct: 61  GFGFLRSPEANYLPGPDDIYVSPSQVRRFGLRTGDTVDGQIRAPKDGERYFALLKVNNIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           F+ PE+VR++I+FDNLTPLYPD++  +E+ +P  KD+++RVIDL+APIGKGQR+LIVAPP
Sbjct: 121 FEDPEKVRHRINFDNLTPLYPDEKLKLEIEDPTRKDLTTRVIDLVAPIGKGQRALIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           RTGKT++LQN+AH+I  NHPE YLIVLLIDERPEEVTDM RSV+GEVISSTFDE A+RHV
Sbjct: 181 RTGKTVMLQNMAHAISLNHPEVYLIVLLIDERPEEVTDMARSVKGEVISSTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QV EMV+ KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRPKRF
Sbjct: 241 QVTEMVLEKAKRLVEHKRDVVILLDSITRLARAYNTVVPSSGKVLTGGVDANALQRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSL+II TAL+DTGSRMDEVIFEEFKGTGNSEI+L+RK++DKR FPA+DI
Sbjct: 301 FGAARNIEEGGSLSIIATALIDTGSRMDEVIFEEFKGTGNSEIILDRKLSDKRTFPAIDI 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
            KSGTRKE+LLV++  L K+++LRRI+  M   DA+EFL+DKLK +K+N DFF +MN
Sbjct: 361 TKSGTRKEELLVDKGILSKMWVLRRILMPMGVVDAMEFLVDKLKHSKNNGDFFEAMN 417


>gi|254472127|ref|ZP_05085527.1| transcription termination factor Rho [Pseudovibrio sp. JE062]
 gi|211958410|gb|EEA93610.1| transcription termination factor Rho [Pseudovibrio sp. JE062]
          Length = 390

 Score =  647 bits (1669), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/389 (78%), Positives = 353/389 (90%)

Query: 32  MRKQELMFSILKVLSGRDVEIIGEGVIEVLQDGFGFLRSPDANYLAGPDDIYVSPSQIKS 91
           MRKQEL+F+ILK L+ +D+EIIGEGV+EVLQDGFGFLRSPDANYL GPDDIYVSPSQI+ 
Sbjct: 1   MRKQELLFAILKRLAEQDIEIIGEGVVEVLQDGFGFLRSPDANYLPGPDDIYVSPSQIRR 60

Query: 92  FSLKTGDTVEGSIRAPREGERYFALLKVNAINFDVPERVRNKIHFDNLTPLYPDKRFNME 151
           FSL+TGDTVEG IR+P+EGERYFALLKVN INF+ PE+ R+K+HFDNLTPLYPD+RFN+E
Sbjct: 61  FSLRTGDTVEGQIRSPKEGERYFALLKVNKINFEDPEKARHKVHFDNLTPLYPDERFNLE 120

Query: 152 LNNPENKDISSRVIDLIAPIGKGQRSLIVAPPRTGKTILLQNIAHSIKKNHPECYLIVLL 211
           + N  +KDIS+R+IDL+AP+GKGQR+LI APPRTGKT+ LQNIA+SI  NHPECYLIVLL
Sbjct: 121 IENNTSKDISARIIDLVAPLGKGQRALITAPPRTGKTVFLQNIANSITTNHPECYLIVLL 180

Query: 212 IDERPEEVTDMQRSVQGEVISSTFDESAARHVQVAEMVIAKAKCLVEYGLDVVILLDSIT 271
           IDERPEEVTDMQR+V GEV+SSTFDE A+RHVQVAEMVI KAK L E+G DVVILLDSIT
Sbjct: 181 IDERPEEVTDMQRTVNGEVVSSTFDEPASRHVQVAEMVIEKAKRLTEHGRDVVILLDSIT 240

Query: 272 RLCRAYNVLMPSSGKILTGGVDANALQRPKRFFGAARNIKEGGSLTIIGTALVDTGSRMD 331
           RL RAYN ++PSSGK+LTGGVDANALQRPKRFFGAARNI+EGGSLTII TAL+DTGSRMD
Sbjct: 241 RLGRAYNTVVPSSGKVLTGGVDANALQRPKRFFGAARNIEEGGSLTIIATALIDTGSRMD 300

Query: 332 EVIFEEFKGTGNSEIVLERKIADKRIFPAMDIIKSGTRKEDLLVERQDLQKVFMLRRIVS 391
           EVIFEEFKGTGNSEI+L+RKI+DKR+FPA+DI +SGTRKE+LLV    L+K F+LRRI+S
Sbjct: 301 EVIFEEFKGTGNSEIILDRKISDKRVFPAVDIQRSGTRKEELLVPADKLKKTFVLRRILS 360

Query: 392 SMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
            M + DA+EFL+DKL+QTK N DFF SMN
Sbjct: 361 QMGTVDAVEFLLDKLRQTKSNDDFFDSMN 389


>gi|254464496|ref|ZP_05077907.1| transcription termination factor Rho [Rhodobacterales bacterium
           Y4I]
 gi|206685404|gb|EDZ45886.1| transcription termination factor Rho [Rhodobacterales bacterium
           Y4I]
          Length = 423

 Score =  647 bits (1668), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/417 (74%), Positives = 361/417 (86%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           + L +LK KSP  LLA AE LEIENA+ MRK E+MF IL+  +    +I G+GV+EVLQD
Sbjct: 6   LNLADLKAKSPKSLLAMAEELEIENASTMRKGEMMFQILRERADEGWDIGGDGVLEVLQD 65

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSP+ANYL GPDDIYVSP  I+ +SL+TGDTVEG I+AP E ERYFAL  V  IN
Sbjct: 66  GFGFLRSPEANYLPGPDDIYVSPDMIRQYSLRTGDTVEGQIKAPLETERYFALTNVTMIN 125

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           F+ PE+ R+KI FDNLTPLYPD+R  ME+ +P  KD S+RVIDL+APIGKGQRSLIVAPP
Sbjct: 126 FEEPEKARHKIAFDNLTPLYPDERLKMEIEDPTIKDRSARVIDLVAPIGKGQRSLIVAPP 185

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           RTGKT++LQNIAHSI+KNHPECYLIVLLIDERPEEVTDMQRSV+GEV+SSTFDE A RHV
Sbjct: 186 RTGKTVILQNIAHSIEKNHPECYLIVLLIDERPEEVTDMQRSVKGEVVSSTFDEPATRHV 245

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
            V+EMVI KAK LVE+  DVVILLDSITRL RA+N ++PSSGK+LTGGVDANALQRPKRF
Sbjct: 246 AVSEMVIEKAKRLVEHKRDVVILLDSITRLGRAFNTVVPSSGKVLTGGVDANALQRPKRF 305

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSE+VL+RKIADKR+FPA+DI
Sbjct: 306 FGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSELVLDRKIADKRVFPAIDI 365

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           +KSGTRKEDLLV++ DL K F+LRRI++ M ++DAIEFL+ KLKQTK N +FF SMN
Sbjct: 366 LKSGTRKEDLLVDKGDLAKTFVLRRILNPMGTTDAIEFLLSKLKQTKSNSEFFDSMN 422


>gi|110677828|ref|YP_680835.1| transcription termination factor Rho [Roseobacter denitrificans OCh
           114]
 gi|109453944|gb|ABG30149.1| transcription termination factor Rho [Roseobacter denitrificans OCh
           114]
          Length = 422

 Score =  647 bits (1668), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/421 (74%), Positives = 366/421 (86%), Gaps = 1/421 (0%)

Query: 1   MSE-MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIE 59
           M+E + L +LK KSP  LL+ AE LEIENA+ MRK E+MF IL+  +    E+ G+GV+E
Sbjct: 1   MTETLNLADLKRKSPKDLLSMAEDLEIENASTMRKGEMMFQILRERADEGWEVSGDGVLE 60

Query: 60  VLQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKV 119
           VLQDGFGFLRSP+ANYL GPDDIYVSP  I+ +SL+TGDT+EG I+AP + ERYFALL V
Sbjct: 61  VLQDGFGFLRSPEANYLPGPDDIYVSPDMIRKYSLRTGDTIEGLIKAPDDNERYFALLGV 120

Query: 120 NAINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLI 179
             INF+ PE+ R+K+ F+NLTPLYPD+R  ME ++P  KD S+R+IDL+APIGKGQRSLI
Sbjct: 121 TQINFEDPEKARHKVAFENLTPLYPDERLTMETDDPTTKDRSARIIDLVAPIGKGQRSLI 180

Query: 180 VAPPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESA 239
           VAPPRTGKT+LLQNIA+SI++NHPECYLIVLLIDERPEEVTDMQRSV+GEV+SSTFDE A
Sbjct: 181 VAPPRTGKTVLLQNIANSIERNHPECYLIVLLIDERPEEVTDMQRSVKGEVVSSTFDEPA 240

Query: 240 ARHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQR 299
            RHV V++MVI KAK LVE+  DVVILLDSITRL RA+N ++PSSGK+LTGGVDANALQR
Sbjct: 241 TRHVAVSDMVIEKAKRLVEHKRDVVILLDSITRLGRAFNTVVPSSGKVLTGGVDANALQR 300

Query: 300 PKRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFP 359
           PKRFFGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RKIADKR+FP
Sbjct: 301 PKRFFGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKIADKRVFP 360

Query: 360 AMDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSM 419
           AMDI+KSGTRKEDLLV++ DLQK F+LRRI++ M ++DAIEFLI KLKQTK N DFF SM
Sbjct: 361 AMDILKSGTRKEDLLVDKIDLQKTFVLRRILNPMGTTDAIEFLISKLKQTKTNSDFFDSM 420

Query: 420 N 420
           N
Sbjct: 421 N 421


>gi|23014742|ref|ZP_00054544.1| COG1158: Transcription termination factor [Magnetospirillum
           magnetotacticum MS-1]
          Length = 418

 Score =  646 bits (1667), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/417 (72%), Positives = 369/417 (88%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M LQ+LK K+P +LLAFAE LE+ENA+ +RKQ++MF+ILK L+  D  I G+GV+E+LQD
Sbjct: 1   MHLQDLKKKTPAELLAFAEELEVENASTLRKQDMMFAILKQLADNDTPIYGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSP+ANYL GPDDIYVSPSQ++ F L+TGDTV+G IR+P++GERYFALLKVN IN
Sbjct: 61  GFGFLRSPEANYLPGPDDIYVSPSQVRRFGLRTGDTVDGQIRSPKDGERYFALLKVNNIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           F+ PE+VR++I+FDNLTPLYPD++  +E+ +P  KD+++RVIDL+APIGKGQR+LIVAPP
Sbjct: 121 FEDPEKVRHRINFDNLTPLYPDEKLKLEIEDPTRKDLTTRVIDLVAPIGKGQRALIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           RTGKT++LQN+AH+I  NHPE YLIVLLIDERPEEVTDM RSV+GEVISSTFDE A+RHV
Sbjct: 181 RTGKTVMLQNMAHAISLNHPEVYLIVLLIDERPEEVTDMARSVKGEVISSTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QV EMV+ KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRPKRF
Sbjct: 241 QVTEMVLEKAKRLVEHKRDVVILLDSITRLARAYNTVVPSSGKVLTGGVDANALQRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSL+II TAL+DTGSRMDEVIFEEFKGTGNSEI+L+RK++DKR FPA+DI
Sbjct: 301 FGAARNIEEGGSLSIIATALIDTGSRMDEVIFEEFKGTGNSEIILDRKLSDKRTFPAIDI 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
            KSGTRKE+LLV++  L K+++LRRI+  M   DA+EFL+DKLK +K+N DFF +MN
Sbjct: 361 TKSGTRKEELLVDKGILSKMWVLRRILMPMGVVDAMEFLVDKLKHSKNNGDFFEAMN 417


>gi|163796503|ref|ZP_02190463.1| Transcription termination factor [alpha proteobacterium BAL199]
 gi|159178353|gb|EDP62897.1| Transcription termination factor [alpha proteobacterium BAL199]
          Length = 419

 Score =  646 bits (1667), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/418 (73%), Positives = 367/418 (87%), Gaps = 1/418 (0%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M LQELK KSP  LL FAE LEIENA+ +RKQ++MF+ILK L+  DV I G+GV+E L D
Sbjct: 1   MNLQELKEKSPADLLQFAEELEIENASTLRKQDMMFAILKQLADNDVAIYGQGVLETLPD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSP++NYL GPDDIYVSPSQ++ F L+TGDTVEG IRAP+EGERYFALLKVNAIN
Sbjct: 61  GFGFLRSPESNYLPGPDDIYVSPSQVRRFGLRTGDTVEGEIRAPKEGERYFALLKVNAIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELN-NPENKDISSRVIDLIAPIGKGQRSLIVAP 182
           F+ P+ VR++I+FDNLTPLYPD++ ++E+   PENK+ ++RVIDLI+P+GKGQR+LIVAP
Sbjct: 121 FEDPDAVRHRINFDNLTPLYPDEKLSLEVPFKPENKEFTTRVIDLISPLGKGQRALIVAP 180

Query: 183 PRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARH 242
           PRTGKT++LQNIAH+I +NHPE YLIVLLIDERPEEVTDM RSV+GEVISSTFDE A RH
Sbjct: 181 PRTGKTVMLQNIAHAIAENHPEVYLIVLLIDERPEEVTDMDRSVKGEVISSTFDEPATRH 240

Query: 243 VQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKR 302
           V V EMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRPKR
Sbjct: 241 VAVTEMVIEKAKRLVEHKRDVVILLDSITRLARAYNTVVPSSGKVLTGGVDANALQRPKR 300

Query: 303 FFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMD 362
           FFGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEI+L+RK+ADKR FPA+D
Sbjct: 301 FFGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIILDRKLADKRTFPAID 360

Query: 363 IIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           I +SGTRKE+LLV++  L K+++LRRI+  M + DA+EFL+DKLK +K+N DFF +MN
Sbjct: 361 ITRSGTRKEELLVDKPVLSKMWVLRRILMQMGTVDAMEFLVDKLKHSKNNADFFDAMN 418


>gi|163732962|ref|ZP_02140406.1| transcription termination factor Rho [Roseobacter litoralis Och
           149]
 gi|161393497|gb|EDQ17822.1| transcription termination factor Rho [Roseobacter litoralis Och
           149]
          Length = 432

 Score =  644 bits (1662), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/417 (74%), Positives = 362/417 (86%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           + L +LK KSP  LL+ AE LEIENA+ MRK E+MF IL+  +    E+ G+GV+EVLQD
Sbjct: 15  LNLADLKRKSPKDLLSMAEDLEIENASTMRKGEMMFQILRERADEGWEVSGDGVLEVLQD 74

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSP+ANYL GPDDIYVSP  I+ +SL+TGDT++G I+AP + ERYFALL V  IN
Sbjct: 75  GFGFLRSPEANYLPGPDDIYVSPEMIRKYSLRTGDTIDGLIKAPDDNERYFALLGVTQIN 134

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           F+ PE+ R+K+ F+NLTPLYPD+R  ME  +P  KD S+R+IDL+APIGKGQRSLIVAPP
Sbjct: 135 FENPEQARHKVAFENLTPLYPDERLTMETEDPATKDRSARIIDLVAPIGKGQRSLIVAPP 194

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           RTGKT+LLQNIA+SI++NHPECYLIVLLIDERPEEVTDMQRSV+GEV+SSTFDE A RHV
Sbjct: 195 RTGKTVLLQNIANSIERNHPECYLIVLLIDERPEEVTDMQRSVKGEVVSSTFDEPATRHV 254

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
            V++MVI KAK LVE+  DVVILLDSITRL RA+N ++PSSGK+LTGGVDANALQRPKRF
Sbjct: 255 AVSDMVIEKAKRLVEHKRDVVILLDSITRLGRAFNTVVPSSGKVLTGGVDANALQRPKRF 314

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RKIADKR+FPAMDI
Sbjct: 315 FGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKIADKRVFPAMDI 374

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           +KSGTRKEDLLV++ DLQK F+LRRI++ M ++DAIEFLI KLKQTK N DFF SMN
Sbjct: 375 LKSGTRKEDLLVDKIDLQKTFVLRRILNPMGTTDAIEFLISKLKQTKTNSDFFDSMN 431


>gi|310817164|ref|YP_003965128.1| transcription termination factor Rho [Ketogulonicigenium vulgare
           Y25]
 gi|308755899|gb|ADO43828.1| transcription termination factor Rho [Ketogulonicigenium vulgare
           Y25]
          Length = 424

 Score =  644 bits (1661), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/423 (73%), Positives = 364/423 (86%), Gaps = 3/423 (0%)

Query: 1   MSE---MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGV 57
           MSE   + L +LK +SP  LLA AE LEIENA+ MRK ++MF+ILK  +  D  I G+GV
Sbjct: 1   MSEEFRLNLSDLKARSPKDLLALAEELEIENASTMRKGDMMFAILKERAEEDWTIGGDGV 60

Query: 58  IEVLQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALL 117
           +EVLQDGFGFLRSP+ANYL GPDDIYVSP  I+ +SL+TGDTV G ++ P E ERYFAL+
Sbjct: 61  LEVLQDGFGFLRSPEANYLPGPDDIYVSPDMIRQYSLRTGDTVSGVMQEPSETERYFALI 120

Query: 118 KVNAINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRS 177
            V  INF+ P+R R+K+ FDNLTPLYPD+R  ME+ +P  KD S+R+IDL+APIGKGQR+
Sbjct: 121 TVETINFEDPDRARHKVAFDNLTPLYPDERLKMEIEDPTIKDRSARIIDLVAPIGKGQRA 180

Query: 178 LIVAPPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDE 237
           LIVAPPRTGKT+LLQNIAHSI+ NHPECYLIVLLIDERPEEVTDMQRSV+GEV+SSTFDE
Sbjct: 181 LIVAPPRTGKTVLLQNIAHSIEVNHPECYLIVLLIDERPEEVTDMQRSVKGEVVSSTFDE 240

Query: 238 SAARHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANAL 297
            A RHV VAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANAL
Sbjct: 241 PATRHVAVAEMVIEKAKRLVEHKRDVVILLDSITRLGRAYNTVVPSSGKVLTGGVDANAL 300

Query: 298 QRPKRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRI 357
           QRPKRFFGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RK+ADKR+
Sbjct: 301 QRPKRFFGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKVADKRV 360

Query: 358 FPAMDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFY 417
           FPA+DI+KSGTRKEDLLV+ +DLQK ++LRRI++ M ++DA++FLI KLKQTK N DFF 
Sbjct: 361 FPAVDILKSGTRKEDLLVDAKDLQKTYVLRRILNPMGTTDAMDFLISKLKQTKSNSDFFD 420

Query: 418 SMN 420
           SMN
Sbjct: 421 SMN 423


>gi|254477270|ref|ZP_05090656.1| transcription termination factor Rho [Ruegeria sp. R11]
 gi|214031513|gb|EEB72348.1| transcription termination factor Rho [Ruegeria sp. R11]
          Length = 423

 Score =  644 bits (1661), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/417 (74%), Positives = 361/417 (86%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           + L +LK KSP  LLA AE LEIENA+ MRK E+MF IL+  +    +I G+GV+EVLQD
Sbjct: 6   LNLSDLKAKSPKALLAMAEELEIENASTMRKGEMMFQILRERADEGWDIGGDGVLEVLQD 65

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSP+ANYL GPDDIYVSP  I+ +SL+TGDTVEG I+AP E ERYFAL  V  IN
Sbjct: 66  GFGFLRSPEANYLPGPDDIYVSPEMIRQYSLRTGDTVEGQIKAPLETERYFALTNVTKIN 125

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           F+ PE+ R+KI FDNLTPLYPD+R  ME+ +P  KD S+RVIDL+APIGKGQRSLIVAPP
Sbjct: 126 FEDPEKARHKIAFDNLTPLYPDERLKMEIEDPTIKDRSARVIDLVAPIGKGQRSLIVAPP 185

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           RTGKT++LQNIA+SI+KNHPECYLIVLLIDERPEEVTDMQRSV+GEV+SSTFDE A RHV
Sbjct: 186 RTGKTVILQNIANSIEKNHPECYLIVLLIDERPEEVTDMQRSVKGEVVSSTFDEPATRHV 245

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
            V+EMVI KAK LVE+  DVVILLDSITRL RA+N ++PSSGK+LTGGVDANALQRPKRF
Sbjct: 246 AVSEMVIEKAKRLVEHKRDVVILLDSITRLGRAFNTVVPSSGKVLTGGVDANALQRPKRF 305

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RKIADKR+FPA+DI
Sbjct: 306 FGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKIADKRVFPAIDI 365

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           +KSGTRKEDLLV++ DL K F+LRRI++ M ++DAIEFL+ KLKQTK N +FF SMN
Sbjct: 366 LKSGTRKEDLLVDKGDLAKTFVLRRILNPMGTTDAIEFLLSKLKQTKTNSEFFDSMN 422


>gi|149912888|ref|ZP_01901422.1| transcription termination factor Rho [Roseobacter sp. AzwK-3b]
 gi|149813294|gb|EDM73120.1| transcription termination factor Rho [Roseobacter sp. AzwK-3b]
          Length = 423

 Score =  644 bits (1660), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/422 (75%), Positives = 359/422 (85%), Gaps = 2/422 (0%)

Query: 1   MSE--MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVI 58
           MSE  + L +LK  S   LLA AE LEIENA+ MRK E+MF IL+  +     + G+GV+
Sbjct: 1   MSEDRLNLCDLKATSAKDLLAMAEELEIENASTMRKGEMMFQILRERADEGWTVFGDGVL 60

Query: 59  EVLQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLK 118
           EVLQDGFGFLRSP+ANYL GPDDIYVSP  I+ FSL+TGDT+EG IRAP E ERYFAL  
Sbjct: 61  EVLQDGFGFLRSPEANYLPGPDDIYVSPETIRQFSLRTGDTIEGEIRAPEENERYFALTT 120

Query: 119 VNAINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSL 178
           V  INF  PER ++KI FDNLTPLYPD+R  ME+ +P  KD S RVIDL+APIGKGQRSL
Sbjct: 121 VKQINFQDPERAKHKIAFDNLTPLYPDERLKMEVEDPTIKDRSPRVIDLVAPIGKGQRSL 180

Query: 179 IVAPPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDES 238
           IVAPPRTGKT+LLQ IA+SI+KNHPECYLIVLLIDERPEEVTDMQRSV+GEVISSTFDE 
Sbjct: 181 IVAPPRTGKTVLLQTIANSIEKNHPECYLIVLLIDERPEEVTDMQRSVKGEVISSTFDEP 240

Query: 239 AARHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQ 298
           AARHV VAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQ
Sbjct: 241 AARHVAVAEMVIEKAKRLVEHKRDVVILLDSITRLGRAYNTVVPSSGKVLTGGVDANALQ 300

Query: 299 RPKRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIF 358
           RPKRFFGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RKIADKR+F
Sbjct: 301 RPKRFFGAARNIEEGGSLTIISTALIDTGSRMDEVIFEEFKGTGNSEIVLDRKIADKRVF 360

Query: 359 PAMDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYS 418
           PA+DI+KSGTRKEDLL+ + DLQK F+LRRI++ M ++DAIEFL+ KLKQTK N +FF S
Sbjct: 361 PAIDILKSGTRKEDLLINKVDLQKTFVLRRILNPMGTTDAIEFLLSKLKQTKTNTEFFDS 420

Query: 419 MN 420
           MN
Sbjct: 421 MN 422


>gi|56698705|ref|YP_169082.1| transcription termination factor Rho [Ruegeria pomeroyi DSS-3]
 gi|56680442|gb|AAV97108.1| transcription termination factor Rho [Ruegeria pomeroyi DSS-3]
          Length = 423

 Score =  644 bits (1660), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/417 (74%), Positives = 361/417 (86%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           + L +LK KSP  LL+ AE LEIENA+ MRK E+MF IL+  +     I G+GV+EVLQD
Sbjct: 6   LNLADLKAKSPKDLLSMAEELEIENASTMRKGEMMFQILRERADEGWTIGGDGVLEVLQD 65

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSP+ANYL GPDDIYVSP  I+ +SL+TGDTVEG I+AP + ERYFAL  V  IN
Sbjct: 66  GFGFLRSPEANYLPGPDDIYVSPDMIRQYSLRTGDTVEGEIKAPDDSERYFALTNVTMIN 125

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           F+ PE+ R+KI FDNLTPLYPD+R  ME+ +P  KD S+RVIDL+APIGKGQRSLIVAPP
Sbjct: 126 FEDPEKARHKIAFDNLTPLYPDERLKMEIEDPTIKDRSARVIDLVAPIGKGQRSLIVAPP 185

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           RTGKT++LQNIAHSI++NHPECYLIVLLIDERPEEVTDMQRSV+GEV+SSTFDE A RHV
Sbjct: 186 RTGKTVILQNIAHSIERNHPECYLIVLLIDERPEEVTDMQRSVKGEVVSSTFDEPATRHV 245

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
            V+EMVI KAK LVE+  DVVILLDSITRL RA+N ++PSSGK+LTGGVDANALQRPKRF
Sbjct: 246 AVSEMVIEKAKRLVEHKRDVVILLDSITRLGRAFNTVVPSSGKVLTGGVDANALQRPKRF 305

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSE+VL+RKIADKR+FPA+DI
Sbjct: 306 FGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSELVLDRKIADKRVFPAIDI 365

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           +KSGTRKEDLLV++ DLQK F+LRRI++ M ++DAIEFL+ KLKQTK N +FF SMN
Sbjct: 366 LKSGTRKEDLLVDKGDLQKTFVLRRILNPMGTTDAIEFLLSKLKQTKTNGEFFDSMN 422


>gi|163737995|ref|ZP_02145411.1| transcription termination factor Rho [Phaeobacter gallaeciensis
           BS107]
 gi|161388611|gb|EDQ12964.1| transcription termination factor Rho [Phaeobacter gallaeciensis
           BS107]
          Length = 423

 Score =  643 bits (1659), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/417 (74%), Positives = 360/417 (86%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           + L +LK KSP  LL+ AE LEIENA+ MRK E+MF IL+  +    EI G+GV+EVLQD
Sbjct: 6   LNLSDLKAKSPKDLLSMAEELEIENASTMRKGEMMFQILRERADEGWEIAGDGVLEVLQD 65

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSP+ANYL GPDDIYVSP  I+ ++L+TGDTV+G I++P E ERYFAL  V  IN
Sbjct: 66  GFGFLRSPEANYLPGPDDIYVSPDMIRQYALRTGDTVDGQIKSPLENERYFALTNVTKIN 125

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           F+ PE+ R+KI FDNLTPLYPD+R  ME+ +P  KD S+RVIDL++PIGKGQRSLIVAPP
Sbjct: 126 FEEPEKARHKIAFDNLTPLYPDERLKMEIEDPTIKDRSARVIDLVSPIGKGQRSLIVAPP 185

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           RTGKT++LQNIAHSI KNHPECYLIVLLIDERPEEVTDMQRSV+GEV+SSTFDE A RHV
Sbjct: 186 RTGKTVILQNIAHSIAKNHPECYLIVLLIDERPEEVTDMQRSVKGEVVSSTFDEPATRHV 245

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
            V+EMVI KAK LVE+  DVVILLDSITRL RA+N ++PSSGK+LTGGVDANALQRPKRF
Sbjct: 246 AVSEMVIEKAKRLVEHKRDVVILLDSITRLGRAFNTVVPSSGKVLTGGVDANALQRPKRF 305

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RKIADKR+FPA+DI
Sbjct: 306 FGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKIADKRVFPAIDI 365

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           +KSGTRKEDLLV++ DL K F+LRRI++ M ++DAIEFL+ KLKQTK N +FF SMN
Sbjct: 366 LKSGTRKEDLLVDKGDLAKTFVLRRILNPMGTTDAIEFLLSKLKQTKTNSEFFDSMN 422


>gi|163745112|ref|ZP_02152472.1| transcription termination factor Rho [Oceanibulbus indolifex
           HEL-45]
 gi|161381930|gb|EDQ06339.1| transcription termination factor Rho [Oceanibulbus indolifex
           HEL-45]
          Length = 423

 Score =  642 bits (1657), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/417 (73%), Positives = 364/417 (87%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           + L +LK ++P  LLA AE LEIENA+ MRK E+MF IL+  +    EI G+GV+EVLQD
Sbjct: 6   LNLADLKAQTPKNLLAMAEELEIENASTMRKGEMMFQILRERADDGWEISGDGVLEVLQD 65

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSP+ANYL GPDDIYVSP  I+ +SL+TGDT+EG I+AP + ERYFAL +V  IN
Sbjct: 66  GFGFLRSPEANYLPGPDDIYVSPDMIRKWSLRTGDTIEGLIKAPDDTERYFALTEVTKIN 125

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           F+ PE+ R+K+ F+NLTPLYPD+R  ME+++P  KD S+R+IDL++PIGKGQRSLIVAPP
Sbjct: 126 FEAPEKARHKVAFENLTPLYPDERLTMEVDDPTIKDRSARIIDLVSPIGKGQRSLIVAPP 185

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           RTGKT+LLQNIA+SI+KNHPECYLIVLLIDERPEEVTDMQRSV+GEV+SSTFDE A RHV
Sbjct: 186 RTGKTVLLQNIANSIEKNHPECYLIVLLIDERPEEVTDMQRSVKGEVVSSTFDEPATRHV 245

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
            V+EMVI KAK LVE+  DVVILLDSITRL RA+N ++PSSGK+LTGGVDANALQRPKRF
Sbjct: 246 AVSEMVIEKAKRLVEHKRDVVILLDSITRLGRAFNTVVPSSGKVLTGGVDANALQRPKRF 305

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RKIADKR+FPA+DI
Sbjct: 306 FGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKIADKRVFPAIDI 365

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           +KSGTRKEDLL+++ DLQK F+LRRI++ M ++DAIEFL+ KLKQTK N DFF SMN
Sbjct: 366 LKSGTRKEDLLIDKIDLQKTFVLRRILNPMGTTDAIEFLLGKLKQTKSNSDFFDSMN 422


>gi|254436970|ref|ZP_05050464.1| transcription termination factor Rho [Octadecabacter antarcticus
           307]
 gi|198252416|gb|EDY76730.1| transcription termination factor Rho [Octadecabacter antarcticus
           307]
          Length = 437

 Score =  641 bits (1653), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/417 (74%), Positives = 356/417 (85%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           + L +LK +SP  LL+ AE LEIENA+ MRK ++MFSILK  +  D  I G+GV+EVLQD
Sbjct: 20  LNLADLKAQSPKDLLSLAEELEIENASTMRKGDMMFSILKERAEDDWVIGGDGVLEVLQD 79

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSP ANYL GPDDIYVSP  I+  SL+TGDTV+G I+ P E ERYFAL KV  IN
Sbjct: 80  GFGFLRSPGANYLPGPDDIYVSPDMIRQHSLRTGDTVDGVIQEPSETERYFALTKVEMIN 139

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           F+ PER R+K+ F+NLTPLYPD+R  ME  +P  KD S+R+IDL+APIGKGQRSLIVAPP
Sbjct: 140 FEDPERARHKVAFENLTPLYPDERLIMETADPTMKDRSARIIDLVAPIGKGQRSLIVAPP 199

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           RTGKT+LLQNIAHSI  NHPECYLIVLLIDERPEEVTDMQRSV+GEV+SSTFDE A RHV
Sbjct: 200 RTGKTVLLQNIAHSIAANHPECYLIVLLIDERPEEVTDMQRSVKGEVVSSTFDEPATRHV 259

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
            V+EMVI KAK LVE+  DVVILLDSITRL RA+N  +PSSGK+LTGGVDANALQRPKRF
Sbjct: 260 AVSEMVIEKAKRLVEHKRDVVILLDSITRLGRAFNTTVPSSGKVLTGGVDANALQRPKRF 319

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RKIADKR+FPAMDI
Sbjct: 320 FGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKIADKRVFPAMDI 379

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           +KSGTRKEDLL+ + DLQK ++LRRI++ M ++DAIEFLI KLKQTK N DFF SMN
Sbjct: 380 LKSGTRKEDLLINKVDLQKTYVLRRILNPMGTTDAIEFLISKLKQTKTNSDFFDSMN 436


>gi|114762195|ref|ZP_01441663.1| transcription termination factor Rho [Pelagibaca bermudensis
           HTCC2601]
 gi|114545219|gb|EAU48222.1| transcription termination factor Rho [Roseovarius sp. HTCC2601]
          Length = 423

 Score =  641 bits (1653), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/417 (73%), Positives = 362/417 (86%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           + L +LK +SP  LL+ AE LEIENA+ MRK E+MF IL+  +    E+ G+GV+EVLQD
Sbjct: 6   LNLSDLKAQSPKDLLSMAEELEIENASTMRKGEMMFQILRERADEGWEVSGDGVLEVLQD 65

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSP+ANYL GPDDIYVSP  I+ +SL+TGDT+EG IRAP   ERYFAL+ V+ IN
Sbjct: 66  GFGFLRSPEANYLPGPDDIYVSPEMIRKYSLRTGDTIEGEIRAPDNEERYFALVDVSKIN 125

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           F+ PER R+K+ FDNLTPLYPD+R  ME+ +P  KD S+R+IDL++PIGKGQRSLIVAPP
Sbjct: 126 FEDPERARHKVAFDNLTPLYPDERLKMEIEDPTIKDRSARIIDLVSPIGKGQRSLIVAPP 185

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           RTGKT+LLQNIA SI+KNHPEC+LIVLLIDERPEEVTDMQRSV+GEV+SSTFDE A RHV
Sbjct: 186 RTGKTVLLQNIATSIEKNHPECFLIVLLIDERPEEVTDMQRSVKGEVVSSTFDEPATRHV 245

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
            V+EMVI KAK LVE+  DVVILLDSITRL RA+N ++PSSGK+LTGGVDANALQRPKRF
Sbjct: 246 AVSEMVIEKAKRLVEHKRDVVILLDSITRLGRAFNTVVPSSGKVLTGGVDANALQRPKRF 305

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSE+VL+RKIADKR+FPA+DI
Sbjct: 306 FGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEVVLDRKIADKRVFPAIDI 365

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           +KSGTRKEDLL+++ DLQK F+LRRI++ M ++DAIEFL+ KLKQTK N +FF SMN
Sbjct: 366 LKSGTRKEDLLIDKVDLQKTFVLRRILNPMGTTDAIEFLLSKLKQTKTNSEFFDSMN 422


>gi|83942026|ref|ZP_00954488.1| transcription termination factor Rho [Sulfitobacter sp. EE-36]
 gi|83953075|ref|ZP_00961797.1| transcription termination factor Rho [Sulfitobacter sp. NAS-14.1]
 gi|83842043|gb|EAP81211.1| transcription termination factor Rho [Sulfitobacter sp. NAS-14.1]
 gi|83847846|gb|EAP85721.1| transcription termination factor Rho [Sulfitobacter sp. EE-36]
          Length = 423

 Score =  641 bits (1653), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/417 (73%), Positives = 361/417 (86%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           + L +LK ++P  LLA AE LEIENA+ MRK E+MF IL+  +    EI G+GV+EVLQD
Sbjct: 6   LNLADLKAQTPKNLLAMAEELEIENASTMRKGEMMFQILRERADEGWEISGDGVLEVLQD 65

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSP+ANYL GPDDIYVSP  I+  SL+TGDT+EG I+AP + ERYFAL  V  IN
Sbjct: 66  GFGFLRSPEANYLPGPDDIYVSPEMIRQHSLRTGDTIEGLIKAPDDAERYFALTDVTKIN 125

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           F+ PE+ R+K+ F+NLTPLYPD+R  ME+++P  KD SSR+IDL++PIGKGQR LIVAPP
Sbjct: 126 FEEPEKARHKVAFENLTPLYPDERLTMEVDDPTIKDRSSRIIDLVSPIGKGQRCLIVAPP 185

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           RTGKT+LLQNIA+SI++NHPECYLIVLLIDERPEEVTDMQRSV+GEV+SSTFDE A RHV
Sbjct: 186 RTGKTVLLQNIANSIEQNHPECYLIVLLIDERPEEVTDMQRSVKGEVVSSTFDEPATRHV 245

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
            V+EMVI KAK LVE+  DVVILLDSITRL RA+N ++PSSGK+LTGGVDANALQRPKRF
Sbjct: 246 AVSEMVIEKAKRLVEHKRDVVILLDSITRLGRAFNTVVPSSGKVLTGGVDANALQRPKRF 305

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RKIADKR+FPA+DI
Sbjct: 306 FGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKIADKRVFPAIDI 365

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           +KSGTRKEDLLV++ DLQK F+LRRI++ M ++DAIEFLI KLKQTK N DFF SMN
Sbjct: 366 LKSGTRKEDLLVDKNDLQKTFVLRRILNPMGTTDAIEFLIGKLKQTKTNSDFFDSMN 422


>gi|126730105|ref|ZP_01745917.1| transcription termination factor Rho [Sagittula stellata E-37]
 gi|126709485|gb|EBA08539.1| transcription termination factor Rho [Sagittula stellata E-37]
          Length = 426

 Score =  640 bits (1652), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/422 (74%), Positives = 362/422 (85%), Gaps = 2/422 (0%)

Query: 1   MSEMKLQ--ELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVI 58
           MSE KL   +LK +SP  LLA AE LEIENA+ MRK E+MF IL+  +     I G+GV+
Sbjct: 4   MSEEKLNLADLKAQSPKDLLAMAEELEIENASTMRKGEMMFQILRERADEGWLIYGDGVL 63

Query: 59  EVLQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLK 118
           EVLQDGFGFLRSP+ANYL GPDDIYVSP  I+  SL+TGD++EG IRAP   ERYFAL+ 
Sbjct: 64  EVLQDGFGFLRSPEANYLPGPDDIYVSPDMIRKHSLRTGDSIEGEIRAPDNEERYFALVS 123

Query: 119 VNAINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSL 178
           V AINF+ PER R+KI FDNLTPLYPD+R  ME+ +P  KD S+R+IDL+ PIGKGQRSL
Sbjct: 124 VGAINFEDPERARHKIAFDNLTPLYPDERLKMEIEDPTIKDRSARIIDLVCPIGKGQRSL 183

Query: 179 IVAPPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDES 238
           IVAPPRTGKT+LLQNIA SI+KNHPECYLIVLLIDERPEEVTDMQRSV+GEVISSTFDE 
Sbjct: 184 IVAPPRTGKTVLLQNIAASIEKNHPECYLIVLLIDERPEEVTDMQRSVKGEVISSTFDEP 243

Query: 239 AARHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQ 298
           A RHV V+EMVI KAK LVE+  DVVILLDSITRL RA+N ++PSSGK+LTGGVDANALQ
Sbjct: 244 ATRHVAVSEMVIEKAKRLVEHKRDVVILLDSITRLGRAFNTVVPSSGKVLTGGVDANALQ 303

Query: 299 RPKRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIF 358
           RPKRFFGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RK+ADKR+F
Sbjct: 304 RPKRFFGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKVADKRVF 363

Query: 359 PAMDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYS 418
           PA+DI+KSGTRKEDLL+++ DLQK F+LRRI++ M ++DAIEFL+ KLKQTK N +FF S
Sbjct: 364 PAIDILKSGTRKEDLLIDKIDLQKTFVLRRILNPMGTTDAIEFLLSKLKQTKTNSEFFDS 423

Query: 419 MN 420
           MN
Sbjct: 424 MN 425


>gi|159045993|ref|YP_001534787.1| transcription termination factor Rho [Dinoroseobacter shibae DFL
           12]
 gi|157913753|gb|ABV95186.1| transcription termination factor Rho [Dinoroseobacter shibae DFL
           12]
          Length = 423

 Score =  640 bits (1652), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/417 (73%), Positives = 360/417 (86%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           + L +LK  SP  LL  AE LE+ENA+ MRK ++MF+ILK  +    EI G+GV+EV+QD
Sbjct: 6   LALADLKAMSPADLLPLAEELEVENASTMRKGDMMFAILKERAEDGWEISGDGVLEVMQD 65

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSP+ANYL GPDDIYVSP +I+  SL+TGDTVEG I+APRE ERYFA+  V+ +N
Sbjct: 66  GFGFLRSPEANYLPGPDDIYVSPEKIRQHSLRTGDTVEGVIQAPRENERYFAITSVSLVN 125

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           F+ PE  R+K+ FDNLTPLYPD+R  ME+ +P  KD S+R+IDL+APIGKGQRSLIVAPP
Sbjct: 126 FEDPEMARHKVSFDNLTPLYPDERLKMEIEDPTIKDRSARIIDLVAPIGKGQRSLIVAPP 185

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           RTGKT+LLQNIA SI  NHPECYL+VLLIDERPEEVTDMQRSV+GEVISSTFDE A+RHV
Sbjct: 186 RTGKTVLLQNIAKSIAANHPECYLMVLLIDERPEEVTDMQRSVKGEVISSTFDEPASRHV 245

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
            V+EMVI KAK LVE+  DVVILLDSITRL RA+N ++PSSGK+LTGGVDANALQRPKRF
Sbjct: 246 AVSEMVIEKAKRLVEHKRDVVILLDSITRLGRAFNTVVPSSGKVLTGGVDANALQRPKRF 305

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RK+ADKR+FPAMDI
Sbjct: 306 FGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKVADKRVFPAMDI 365

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           +KSGTRKEDLLV+ +DLQK F+LRRI++ M ++DAIEFLI KLKQTK N +FF SMN
Sbjct: 366 LKSGTRKEDLLVDAKDLQKTFVLRRILNPMGTTDAIEFLISKLKQTKTNSEFFDSMN 422


>gi|89067423|ref|ZP_01154936.1| transcription termination factor Rho [Oceanicola granulosus
           HTCC2516]
 gi|89046992|gb|EAR53046.1| transcription termination factor Rho [Oceanicola granulosus
           HTCC2516]
          Length = 423

 Score =  640 bits (1651), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/417 (73%), Positives = 361/417 (86%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           + L +LK +SP  LL+ AE LEIENA+ MRK ++MF+ILK  +  D  I G+GV+EVLQD
Sbjct: 6   LNLADLKAQSPKDLLSLAEELEIENASTMRKGDMMFAILKERAEDDWVIGGDGVLEVLQD 65

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSP+ANYL GPDDIYVSP  I+ +SL+TGDTVEG I+ P + ERYFAL+ V AIN
Sbjct: 66  GFGFLRSPEANYLPGPDDIYVSPDMIRQYSLRTGDTVEGVIQEPNDNERYFALVSVEAIN 125

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           F+ PE+ R+K+ FDNLTPLYPD+R  ME+     KD S+R+IDL++PIGKGQRSLIVAPP
Sbjct: 126 FEEPEKARHKVAFDNLTPLYPDERLKMEIETEVTKDRSARIIDLVSPIGKGQRSLIVAPP 185

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           RTGKT+LLQNIAHSI+KNHPECYLIVLLIDERPEEVTDMQRSV+GEV+SSTFDE A+RHV
Sbjct: 186 RTGKTVLLQNIAHSIEKNHPECYLIVLLIDERPEEVTDMQRSVKGEVVSSTFDEPASRHV 245

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
            V+EMVI KAK LVE+  DVVILLDSITRL RA+N  +PSSGK+LTGGVDANALQRPKRF
Sbjct: 246 AVSEMVIEKAKRLVEHKRDVVILLDSITRLGRAFNTTVPSSGKVLTGGVDANALQRPKRF 305

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RK+ADKR+FPAMDI
Sbjct: 306 FGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKVADKRVFPAMDI 365

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           +KSGTRKE+LL ++ DLQK ++LRRI++ M ++DAIEFLI KLKQTK N +FF SMN
Sbjct: 366 LKSGTRKEELLTDKVDLQKTYVLRRILNPMGTTDAIEFLISKLKQTKSNAEFFESMN 422


>gi|84514919|ref|ZP_01002282.1| transcription termination factor Rho [Loktanella vestfoldensis
           SKA53]
 gi|84511078|gb|EAQ07532.1| transcription termination factor Rho [Loktanella vestfoldensis
           SKA53]
          Length = 418

 Score =  640 bits (1650), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/417 (74%), Positives = 360/417 (86%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L +LK +SP  LL+ AE LEIENA+ MRK ++MF+ILK  +  +  I G+GV+EVLQD
Sbjct: 1   MNLADLKAQSPKDLLSMAEELEIENASTMRKGDMMFAILKERADDEWVIGGDGVLEVLQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSP+ANYL GPDDIYVSP  I+ +SL+TGDTVEG ++ P + ERYFAL  V  IN
Sbjct: 61  GFGFLRSPEANYLPGPDDIYVSPDMIRQYSLRTGDTVEGVMKEPNDNERYFALTSVERIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           F+ PER R+K+ FDNLTPLYP++R  ME+ +P  KD S+R+IDL+APIGKGQRSLIVAPP
Sbjct: 121 FEDPERARHKVAFDNLTPLYPEERLTMEIADPTVKDRSARIIDLVAPIGKGQRSLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           RTGKT+LLQNIA+SI+KNHPECYLIVLLIDERPEEVTDMQRSV+GEV+SSTFDE A RHV
Sbjct: 181 RTGKTVLLQNIANSIEKNHPECYLIVLLIDERPEEVTDMQRSVKGEVVSSTFDEPATRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
            VAEMVI KAK LVE+  DVVILLDSITRL RA+N  +PSSGK+LTGGVDANALQRPKRF
Sbjct: 241 AVAEMVIEKAKRLVEHKRDVVILLDSITRLGRAFNTTVPSSGKVLTGGVDANALQRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RK+ADKR+FPAMDI
Sbjct: 301 FGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKVADKRVFPAMDI 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           +KSGTRKE+LLVE+ DL K ++LRRI++ M ++DAIEFLI KLKQTK N DFF SMN
Sbjct: 361 LKSGTRKEELLVEKSDLAKTYVLRRILNPMGTTDAIEFLIGKLKQTKTNSDFFDSMN 417


>gi|126724527|ref|ZP_01740370.1| transcription termination factor Rho [Rhodobacterales bacterium
           HTCC2150]
 gi|126705691|gb|EBA04781.1| transcription termination factor Rho [Rhodobacterales bacterium
           HTCC2150]
          Length = 423

 Score =  639 bits (1647), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/417 (72%), Positives = 364/417 (87%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           + L++LK +SP  LL  AE LEI+NA+ MRK E+MFSILK  +  D EI G+GV+EV+QD
Sbjct: 6   VNLRDLKAQSPKDLLNLAEELEIDNASTMRKGEMMFSILKERAEDDWEIGGDGVLEVMQD 65

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSP+ANYL+GPDDIYVSP  I+ FSL+TGDT+ G ++APRE ERYF++  V +IN
Sbjct: 66  GFGFLRSPEANYLSGPDDIYVSPEMIRQFSLRTGDTISGVMQAPREEERYFSMTNVESIN 125

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           F+ PE+ R+K+ FDNLTPLYPD+R  ME+ +P  KD S+R+IDL+APIGKGQRSLIVAPP
Sbjct: 126 FEEPEKARHKVAFDNLTPLYPDERLKMEIEDPTIKDKSARIIDLVAPIGKGQRSLIVAPP 185

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           RTGKT+LLQNIA SI+KNHPECYLIVLLIDERPEEVTDMQRSV+GEV+SSTFDE A RHV
Sbjct: 186 RTGKTVLLQNIATSIEKNHPECYLIVLLIDERPEEVTDMQRSVKGEVVSSTFDEPATRHV 245

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
            V++MVI KAK LVE+  DVVILLDSITRL RA+N ++PSSGK+LTGGVDANALQRPKRF
Sbjct: 246 AVSDMVIEKAKRLVEHKRDVVILLDSITRLGRAFNTVVPSSGKVLTGGVDANALQRPKRF 305

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RK+ADKR++PAMDI
Sbjct: 306 FGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKVADKRVYPAMDI 365

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           +KSGTRKE+LLV++ +LQK ++LRRI++ M ++D IEFL+ KLKQTK N DFF SMN
Sbjct: 366 LKSGTRKEELLVDKMNLQKTYVLRRILNPMGTTDGIEFLLGKLKQTKSNADFFDSMN 422


>gi|126734407|ref|ZP_01750154.1| transcription termination factor Rho [Roseobacter sp. CCS2]
 gi|126717273|gb|EBA14137.1| transcription termination factor Rho [Roseobacter sp. CCS2]
          Length = 418

 Score =  639 bits (1647), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/417 (73%), Positives = 362/417 (86%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L +LK +SP  LL+ AE LEIENA+ MRK ++MF+ILK  +  +  I G+GV+EVLQD
Sbjct: 1   MNLADLKAQSPKDLLSLAEELEIENASTMRKGDMMFAILKERADEEWVIGGDGVLEVLQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSP+ANYL GPDDIYVSP  I+  SL+TGDTVEG ++ P + ERYFAL+ V  IN
Sbjct: 61  GFGFLRSPEANYLPGPDDIYVSPDMIRKHSLRTGDTVEGVMKEPNDTERYFALMSVEKIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           F+ PER ++K+ FDNLTPLYP++RFN+E+ +P  KD S+R+IDL+APIGKGQRSLIVAPP
Sbjct: 121 FEEPERAKHKVAFDNLTPLYPEERFNLEVEDPTIKDKSARIIDLVAPIGKGQRSLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           RTGKT+LLQNIA+SI+KNHPECYLIVLLIDERPEEVTDMQRSV+GEV+SSTFDE A RHV
Sbjct: 181 RTGKTVLLQNIANSIEKNHPECYLIVLLIDERPEEVTDMQRSVKGEVVSSTFDEPATRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
            V+EMVI KAK LVE+  DVVILLDSITRL RA+N  +PSSGK+LTGGVDANALQRPKRF
Sbjct: 241 AVSEMVIEKAKRLVEHKRDVVILLDSITRLGRAFNTTVPSSGKVLTGGVDANALQRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RK+ADKR+FPAMDI
Sbjct: 301 FGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKVADKRVFPAMDI 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           +KSGTRKE+LLV++ DL K ++LRRI++ M ++DAIEFLI KLKQTK N DFF SMN
Sbjct: 361 LKSGTRKEELLVDKGDLAKTYVLRRILNPMGTTDAIEFLIGKLKQTKTNSDFFDSMN 417


>gi|254511852|ref|ZP_05123919.1| transcription termination factor Rho [Rhodobacteraceae bacterium
           KLH11]
 gi|221535563|gb|EEE38551.1| transcription termination factor Rho [Rhodobacteraceae bacterium
           KLH11]
          Length = 423

 Score =  639 bits (1647), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/417 (73%), Positives = 359/417 (86%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           + L +LK KSP  LLA AE LE+ENA+ MRK E+MF IL+  +     I G+GV+EVLQD
Sbjct: 6   LNLADLKAKSPKDLLAMAEELEVENASTMRKGEMMFQILRERADEGWTIGGDGVLEVLQD 65

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSP+ANYL GPDDIYVSP  I+  SL+TGDTVEG I+AP E ERYFAL  V  IN
Sbjct: 66  GFGFLRSPEANYLPGPDDIYVSPDMIRKHSLRTGDTVEGEIKAPDENERYFALTNVTKIN 125

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           F+ P++ ++KI FDNLTPLYPD+R  ME+ +P  KD S+RVIDL++PIGKGQRSLIVAPP
Sbjct: 126 FENPDKAKHKILFDNLTPLYPDERLKMEIEDPTIKDKSARVIDLVSPIGKGQRSLIVAPP 185

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           RTGKT++LQNIAHSI++NHPECYLIVLLIDERPEEVTDMQRSV+GEV+SSTFDE A RHV
Sbjct: 186 RTGKTVILQNIAHSIEQNHPECYLIVLLIDERPEEVTDMQRSVKGEVVSSTFDEPATRHV 245

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
            V+EMVI KAK LVE+  DVVILLDSITRL RA+N ++PSSGK+LTGGVDANALQRPKRF
Sbjct: 246 AVSEMVIEKAKRLVEHKRDVVILLDSITRLGRAFNTVVPSSGKVLTGGVDANALQRPKRF 305

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RKIADKR+FPA+DI
Sbjct: 306 FGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKIADKRVFPAIDI 365

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           +KSGTRKEDLLV++ DL K F+LRRI++ M ++DAIEFL+ KLKQTK N +FF SMN
Sbjct: 366 LKSGTRKEDLLVDKGDLAKTFVLRRILNPMGTTDAIEFLLSKLKQTKTNSEFFDSMN 422


>gi|255262677|ref|ZP_05342019.1| transcription termination factor Rho [Thalassiobium sp. R2A62]
 gi|255105012|gb|EET47686.1| transcription termination factor Rho [Thalassiobium sp. R2A62]
          Length = 423

 Score =  638 bits (1646), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/417 (74%), Positives = 361/417 (86%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           + L +LK +SP  LL+ AE LEIENA+ MRK ++MFSILK  +  D  I G+GV+EVLQD
Sbjct: 6   LNLSDLKAQSPKDLLSMAEELEIENASTMRKGDMMFSILKERAEDDWIIGGDGVLEVLQD 65

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSP+ANYL GPDDIYVSP  I+  SL+TGDTV G I+ P + ERYF L KV +IN
Sbjct: 66  GFGFLRSPEANYLPGPDDIYVSPDMIRQLSLRTGDTVMGVIQEPNDTERYFCLTKVESIN 125

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           F+ PER ++K+ FDNLTPLYPD+R NME+ +P  KD S+R+IDL++PIGKGQRSLIVAPP
Sbjct: 126 FEEPERAKHKVAFDNLTPLYPDERLNMEVADPTIKDRSARIIDLVSPIGKGQRSLIVAPP 185

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           RTGKT+LLQNIA SI+KNHPECYLIVLLIDERPEEVTDMQRSV+GEV+SSTFDE A+RHV
Sbjct: 186 RTGKTVLLQNIASSIEKNHPECYLIVLLIDERPEEVTDMQRSVKGEVVSSTFDEPASRHV 245

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
            V+EMVI KAK LVE+  DVVILLDSITRL RA+N  +PSSGK+LTGGVDANALQRPKRF
Sbjct: 246 AVSEMVIEKAKRLVEHKRDVVILLDSITRLGRAFNTTVPSSGKVLTGGVDANALQRPKRF 305

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RK+ADKR+FPAMDI
Sbjct: 306 FGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKVADKRVFPAMDI 365

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           +KSGTRKE+LLV++ DLQK ++LRRI++ M ++DAIEFLI KLKQTK N DFF SMN
Sbjct: 366 LKSGTRKEELLVDKIDLQKTYVLRRILNPMGTTDAIEFLISKLKQTKSNSDFFDSMN 422


>gi|254449934|ref|ZP_05063371.1| transcription termination factor Rho [Octadecabacter antarcticus
           238]
 gi|198264340|gb|EDY88610.1| transcription termination factor Rho [Octadecabacter antarcticus
           238]
          Length = 437

 Score =  637 bits (1644), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/417 (74%), Positives = 355/417 (85%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           + L +LK +SP  LL+ AE LEIENA+ MRK ++MFSILK  +  D  I G+GV+EVLQD
Sbjct: 20  LNLADLKAQSPKDLLSLAEELEIENASTMRKGDIMFSILKERAEDDWIIGGDGVLEVLQD 79

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSP ANYL GPDDIYVSP  I+  SL+TGDTV+G I+ P E ERYFAL KV  IN
Sbjct: 80  GFGFLRSPGANYLPGPDDIYVSPDMIRLHSLRTGDTVDGVIQEPSETERYFALTKVEMIN 139

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           F+ PER R+K+ F+NLTPLYPD+R  ME  +P  KD S+R+IDL+APIGKGQR LIVAPP
Sbjct: 140 FEDPERARHKVAFENLTPLYPDERLIMETADPTMKDRSARIIDLVAPIGKGQRCLIVAPP 199

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           RTGKT+LLQNIAHSI  NHPECYLIVLLIDERPEEVTDMQRSV+GEV+SSTFDE A RHV
Sbjct: 200 RTGKTVLLQNIAHSIAANHPECYLIVLLIDERPEEVTDMQRSVKGEVVSSTFDEPATRHV 259

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
            V+EMVI KAK LVE+  DVVILLDSITRL RA+N  +PSSGK+LTGGVDANALQRPKRF
Sbjct: 260 AVSEMVIEKAKRLVEHKRDVVILLDSITRLGRAFNTTVPSSGKVLTGGVDANALQRPKRF 319

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RKIADKR+FPAMDI
Sbjct: 320 FGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKIADKRVFPAMDI 379

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           +KSGTRKEDLL+ + DLQK F+LRRI++ M ++DAIEFLI KLKQTK N DFF SMN
Sbjct: 380 LKSGTRKEDLLINKVDLQKTFVLRRILNPMGTTDAIEFLISKLKQTKTNSDFFDSMN 436


>gi|294085210|ref|YP_003551970.1| transcription termination factor [Candidatus Puniceispirillum
           marinum IMCC1322]
 gi|292664785|gb|ADE39886.1| Transcription termination factor [Candidatus Puniceispirillum
           marinum IMCC1322]
          Length = 423

 Score =  637 bits (1643), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 303/418 (72%), Positives = 362/418 (86%), Gaps = 1/418 (0%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M LQELK KSP  LLA+AE LEIENA+ +RKQ++MF+ILK L+  DV I G GV+EVL D
Sbjct: 5   MHLQELKQKSPADLLAYAEELEIENASTLRKQDMMFAILKQLADNDVSIYGSGVLEVLSD 64

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLR+P++NYL GPDDIYVSPSQ++ FSL+TGDTVEG IRAP++GERYFALLK+  IN
Sbjct: 65  GFGFLRAPESNYLPGPDDIYVSPSQVRRFSLRTGDTVEGEIRAPKDGERYFALLKIQTIN 124

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELN-NPENKDISSRVIDLIAPIGKGQRSLIVAP 182
           F+ P  VR +I+FDNLTPLYP+++  +EL  +P+ KD + RVIDL+AP+GKGQR LIVAP
Sbjct: 125 FEEPSAVRQRINFDNLTPLYPEEKLTLELPFDPDKKDNTPRVIDLVAPMGKGQRGLIVAP 184

Query: 183 PRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARH 242
           PRTGKT++LQ+IAH+I +NHPE YLIVLLIDERPEEVTDMQRSV+GEVISSTFDE A+RH
Sbjct: 185 PRTGKTMMLQSIAHAISENHPEVYLIVLLIDERPEEVTDMQRSVKGEVISSTFDEPASRH 244

Query: 243 VQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKR 302
           VQV EMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRPKR
Sbjct: 245 VQVTEMVIEKAKRLVEHKRDVVILLDSITRLARAYNTVVPSSGKVLTGGVDANALQRPKR 304

Query: 303 FFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMD 362
           FFGAARNI+EGGSLTII TAL++TGSRMDEVIFEEFKGTGNSE++L+RK++DKR FPA+D
Sbjct: 305 FFGAARNIEEGGSLTIIATALIETGSRMDEVIFEEFKGTGNSEVILDRKLSDKRTFPAID 364

Query: 363 IIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           I KSGTRKE+LLV++  L K+++LRRI+  M + DA+EFL DKLK +K N DFF  MN
Sbjct: 365 ITKSGTRKEELLVDKGTLAKMWVLRRILMQMGAIDAMEFLTDKLKHSKTNDDFFDQMN 422


>gi|330991282|ref|ZP_08315233.1| Transcription termination factor Rho [Gluconacetobacter sp. SXCC-1]
 gi|329761301|gb|EGG77794.1| Transcription termination factor Rho [Gluconacetobacter sp. SXCC-1]
          Length = 436

 Score =  637 bits (1642), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 306/435 (70%), Positives = 363/435 (83%), Gaps = 18/435 (4%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M+L ELK KSP  LLA+AESL IENA+ +RKQELMF+ILK L+  D  I G+G +E+L D
Sbjct: 1   MQLAELKAKSPADLLAYAESLNIENASSLRKQELMFTILKTLADNDQAIYGDGTLEILSD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSP+ANYL GPDDIY+SPSQ++ F L+TGDTVEG IRAPR+GERYFALLKVNAIN
Sbjct: 61  GFGFLRSPEANYLPGPDDIYISPSQVRRFGLRTGDTVEGQIRAPRDGERYFALLKVNAIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPE------------------NKDISSRVI 165
           F+ PE VR +I+FDNLTPLYP++R  ME+ N                    N+D +SRVI
Sbjct: 121 FEPPEAVRQRINFDNLTPLYPERRLKMEVENSAVGGADEVPTNGKGKGKAPNRDFTSRVI 180

Query: 166 DLIAPIGKGQRSLIVAPPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRS 225
           DL++PIG GQR+LIVAPPRTGKT++LQ+IA SI  NHPE +LIVLLIDERPEEVTDM RS
Sbjct: 181 DLVSPIGMGQRALIVAPPRTGKTVMLQSIASSISANHPEVFLIVLLIDERPEEVTDMARS 240

Query: 226 VQGEVISSTFDESAARHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSG 285
           V+GEV+SSTFDE A RHVQV EMV+ KAK LVE+  DVVILLDSITRL RAYN ++PSSG
Sbjct: 241 VRGEVVSSTFDEPATRHVQVTEMVLEKAKRLVEHKRDVVILLDSITRLARAYNTVVPSSG 300

Query: 286 KILTGGVDANALQRPKRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSE 345
           K+LTGGVDANALQRPKRFFGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSE
Sbjct: 301 KVLTGGVDANALQRPKRFFGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSE 360

Query: 346 IVLERKIADKRIFPAMDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDK 405
           ++L+RK+ADKR FPA+DI KSGTRKE+LLV+R DL K+++LRRI++ M + DA++FL+DK
Sbjct: 361 LILDRKLADKRTFPAIDITKSGTRKEELLVDRADLAKMWVLRRILAPMGTMDAMDFLLDK 420

Query: 406 LKQTKDNKDFFYSMN 420
           LK +K N DFF +MN
Sbjct: 421 LKYSKTNHDFFDAMN 435


>gi|254487548|ref|ZP_05100753.1| transcription termination factor Rho [Roseobacter sp. GAI101]
 gi|214044417|gb|EEB85055.1| transcription termination factor Rho [Roseobacter sp. GAI101]
          Length = 423

 Score =  637 bits (1642), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 305/417 (73%), Positives = 361/417 (86%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           + L +LK ++P  LLA AE LEIENA+ MRK E+MF IL+  +    EI G+GV+EVLQD
Sbjct: 6   LNLADLKAQTPKNLLAMAEELEIENASTMRKGEMMFQILRERADEGWEISGDGVLEVLQD 65

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSP+ANYL GPDDIY+SP  ++  SL+TGDT+EG I+AP + ERYFAL +V  IN
Sbjct: 66  GFGFLRSPEANYLPGPDDIYLSPEMLRQHSLRTGDTIEGLIKAPDDTERYFALTEVTKIN 125

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           F+ PE+ R+K+ F+NLTPLYPD+R  ME+ +P  KD S+R+IDL+APIGKGQR LIVAPP
Sbjct: 126 FEDPEKARHKVAFENLTPLYPDERMTMEVEDPTIKDRSARIIDLVAPIGKGQRCLIVAPP 185

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           RTGKT+LLQNIA+SI+KNHPECYLIVLLIDERPEEVTDMQRSV+GEV+SSTFDE A RHV
Sbjct: 186 RTGKTVLLQNIANSIEKNHPECYLIVLLIDERPEEVTDMQRSVKGEVVSSTFDEPATRHV 245

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
            V+EMVI KAK LVE+  DVVILLDSITRL RA+N ++PSSGK+LTGGVDANALQRPKRF
Sbjct: 246 AVSEMVIEKAKRLVEHKRDVVILLDSITRLGRAFNTVVPSSGKVLTGGVDANALQRPKRF 305

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RKIADKR+FPA+DI
Sbjct: 306 FGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKIADKRVFPAIDI 365

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           +KSGTRKEDLL+++ DLQK F+LRRI++ M ++DAIEFL+ KLKQTK N DFF SMN
Sbjct: 366 LKSGTRKEDLLIDKVDLQKTFVLRRILNPMGTTDAIEFLLGKLKQTKSNSDFFDSMN 422


>gi|86136755|ref|ZP_01055333.1| transcription termination factor Rho [Roseobacter sp. MED193]
 gi|85826079|gb|EAQ46276.1| transcription termination factor Rho [Roseobacter sp. MED193]
          Length = 423

 Score =  636 bits (1640), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 305/417 (73%), Positives = 360/417 (86%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           + L +LK +SP  LL+ AE LEIENA+ MRK E+MF IL+  +    EI G+GV+EVLQD
Sbjct: 6   LNLSDLKAQSPKNLLSMAEELEIENASTMRKGEMMFQILRERADEGWEIGGDGVLEVLQD 65

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSP+ANYL GPDDIYVSP  I+  SL+TGDT+EG I+AP + ERYFA+  V  IN
Sbjct: 66  GFGFLRSPEANYLPGPDDIYVSPEMIRKHSLRTGDTIEGQIKAPLDAERYFAMTSVTKIN 125

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           F+ PE+ R+KI FDNLTPLYPD+R  ME+ +P  KD S+RVIDL+APIGKGQRSLIVAPP
Sbjct: 126 FEDPEKARHKIAFDNLTPLYPDERLKMEVEDPTLKDRSARVIDLVAPIGKGQRSLIVAPP 185

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           RTGKT++LQNIA+SI+KNHPECYLIVLLIDERPEEVTDMQRSV+GEV+SSTFDE A RHV
Sbjct: 186 RTGKTMILQNIANSIEKNHPECYLIVLLIDERPEEVTDMQRSVKGEVVSSTFDEPATRHV 245

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
            V+EMVI KAK LVE+  DVVILLDSITRL RA+N ++PSSGK+LTGGVDANALQRPKRF
Sbjct: 246 AVSEMVIEKAKRLVEHKRDVVILLDSITRLGRAFNTVVPSSGKVLTGGVDANALQRPKRF 305

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSE+VL+RKIADKR++PA+DI
Sbjct: 306 FGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSELVLDRKIADKRVYPAIDI 365

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           +KSGTRKE+LLV++ DL K F+LRRI++ M ++DA+EFL+ KLKQTK N DFF SMN
Sbjct: 366 LKSGTRKEELLVDKGDLAKTFVLRRILNPMGTTDAVEFLLGKLKQTKSNSDFFDSMN 422


>gi|302381480|ref|YP_003817303.1| transcription termination factor Rho [Brevundimonas subvibrioides
           ATCC 15264]
 gi|302192108|gb|ADK99679.1| transcription termination factor Rho [Brevundimonas subvibrioides
           ATCC 15264]
          Length = 482

 Score =  634 bits (1635), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 298/417 (71%), Positives = 360/417 (86%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           + LQEL +KSP +L+AFAE L+IENA+ +RKQ+L+F+ILK L+  +VEII  G +E+L D
Sbjct: 65  ITLQELNDKSPVELVAFAEQLDIENASNLRKQDLLFAILKTLADEEVEIIASGTLEMLPD 124

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSPDANYL GPDD+YVSPSQI+ F L++GDTV G++R PREGERYFALLKV+ IN
Sbjct: 125 GFGFLRSPDANYLPGPDDVYVSPSQIRRFGLRSGDTVHGAVRGPREGERYFALLKVDTIN 184

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           F+ PE VR K++FDNLTPLYP++R  ME+ +P  +D S RVID++AP+GKGQR LIVAPP
Sbjct: 185 FEDPETVRTKVNFDNLTPLYPNERLIMEIQDPTLRDRSGRVIDIVAPLGKGQRCLIVAPP 244

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           R GKT++LQNIA SI+ NHPE  LIVLLIDERPEEVTDMQR+V+GEV++STFDE A RHV
Sbjct: 245 RVGKTVMLQNIAKSIEANHPEVALIVLLIDERPEEVTDMQRTVKGEVVASTFDEPATRHV 304

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
            VAEMVI KAK LVE+  DVVILLDS+TRL RAYN  +PSSGK+LTGGVDANALQRPKRF
Sbjct: 305 AVAEMVIEKAKRLVEHKRDVVILLDSVTRLGRAYNATVPSSGKVLTGGVDANALQRPKRF 364

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RK+ADKRIFPA+D+
Sbjct: 365 FGAARNVEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKVADKRIFPAIDV 424

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           +KSGTRKE+L+  +  L K ++LRRI++ M   DAIEFL+DKL+Q+K+N DFF SMN
Sbjct: 425 LKSGTRKEELITPKDQLTKTYVLRRILNPMGPQDAIEFLLDKLRQSKNNADFFQSMN 481


>gi|329891177|ref|ZP_08269520.1| transcription termination factor Rho [Brevundimonas diminuta ATCC
           11568]
 gi|328846478|gb|EGF96042.1| transcription termination factor Rho [Brevundimonas diminuta ATCC
           11568]
          Length = 416

 Score =  633 bits (1632), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 298/415 (71%), Positives = 360/415 (86%)

Query: 6   LQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQDGF 65
           +QEL  K+P  L+AFAE L+IENA  +RKQ+L+F+ILK L+  +VEII  GV+E+L DGF
Sbjct: 1   MQELNEKTPEDLVAFAEGLDIENAGNLRKQDLLFAILKTLADEEVEIIASGVLEILPDGF 60

Query: 66  GFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAINFD 125
           GFLRSPDANYL GPDD+YVSPSQI+ F L++GDTV G++R PREGERYFALLKV+ INF+
Sbjct: 61  GFLRSPDANYLPGPDDVYVSPSQIRRFGLRSGDTVHGAVRGPREGERYFALLKVDTINFE 120

Query: 126 VPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPPRT 185
            PE V+ K+ FDNLTPLYP++R +ME+ +P  KD S RVID++AP+GKGQR LIVAPPR 
Sbjct: 121 DPEMVKTKVLFDNLTPLYPEERLHMEIQDPTLKDRSGRVIDIVAPLGKGQRCLIVAPPRV 180

Query: 186 GKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHVQV 245
           GKT++LQNIA SI++NHPE +LIVLLIDERPEEVTDMQR+V+GEV++STFDE A+RHV V
Sbjct: 181 GKTVMLQNIAKSIERNHPEVFLIVLLIDERPEEVTDMQRTVKGEVVASTFDEPASRHVAV 240

Query: 246 AEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRFFG 305
           AEMVI KAK LVE+  DVVILLDSITRL RAYN  +PSSGK+LTGGVDANALQRPKRFFG
Sbjct: 241 AEMVIEKAKRLVEHKKDVVILLDSITRLGRAYNATVPSSGKVLTGGVDANALQRPKRFFG 300

Query: 306 AARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDIIK 365
           AARN+++GGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RK+ADKRIFPA+D++K
Sbjct: 301 AARNVEQGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKVADKRIFPAIDVLK 360

Query: 366 SGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           SGTRKEDL+  +  L K ++LRRI++ M   DAIEFL+DKL+Q+K+N DFF SMN
Sbjct: 361 SGTRKEDLITPKDQLAKTYVLRRILNPMGPQDAIEFLLDKLRQSKNNGDFFQSMN 415


>gi|89052689|ref|YP_508140.1| transcription termination factor Rho [Jannaschia sp. CCS1]
 gi|88862238|gb|ABD53115.1| transcription termination factor Rho [Jannaschia sp. CCS1]
          Length = 402

 Score =  633 bits (1632), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 303/401 (75%), Positives = 351/401 (87%)

Query: 20  FAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQDGFGFLRSPDANYLAGP 79
            AE LEIENA+ MRK ++MF IL+  +    EI G+GV+EVLQDGFGFLRSP+ANYLAGP
Sbjct: 1   MAEELEIENASTMRKGDMMFEILRERADEGWEISGDGVLEVLQDGFGFLRSPEANYLAGP 60

Query: 80  DDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAINFDVPERVRNKIHFDNL 139
           DDIYVSP  I+  SL+TGDTVEG + AP+E ERYF L+ V  INF+ PE+ ++K+ FDNL
Sbjct: 61  DDIYVSPDMIRQHSLRTGDTVEGVMSAPKENERYFCLVNVTQINFEEPEKAKHKVAFDNL 120

Query: 140 TPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPPRTGKTILLQNIAHSIK 199
           TPLYPD+R NME+ +P  KD S+R+IDL++PIGKGQRSLIVAPPRTGKT+LLQNIAHSI+
Sbjct: 121 TPLYPDQRMNMEIEDPTIKDRSARIIDLVSPIGKGQRSLIVAPPRTGKTVLLQNIAHSIE 180

Query: 200 KNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHVQVAEMVIAKAKCLVEY 259
            NHPECYLIVLLIDERPEEVTDMQRSV+GEVISSTFDE A RHV V+EMVI KAK LVE+
Sbjct: 181 TNHPECYLIVLLIDERPEEVTDMQRSVKGEVISSTFDEPATRHVAVSEMVIEKAKRLVEH 240

Query: 260 GLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRFFGAARNIKEGGSLTII 319
             DVVILLDSITRL RA+N ++PSSGK+LTGGVDANALQRPKRFFGAARNI+EGGSLTII
Sbjct: 241 KRDVVILLDSITRLGRAFNTVVPSSGKVLTGGVDANALQRPKRFFGAARNIEEGGSLTII 300

Query: 320 GTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDIIKSGTRKEDLLVERQD 379
            TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RKIADKR++PAMDI+KSGTRKEDLLV++ D
Sbjct: 301 ATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKIADKRVYPAMDILKSGTRKEDLLVDKGD 360

Query: 380 LQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           LQK F+LRRI++ M ++DAIEFLI KLKQTK N +FF SMN
Sbjct: 361 LQKTFVLRRILNPMGTTDAIEFLISKLKQTKTNSEFFDSMN 401


>gi|254420593|ref|ZP_05034317.1| transcription termination factor Rho [Brevundimonas sp. BAL3]
 gi|196186770|gb|EDX81746.1| transcription termination factor Rho [Brevundimonas sp. BAL3]
          Length = 477

 Score =  632 bits (1629), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 298/417 (71%), Positives = 359/417 (86%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           + L EL  K+P  L+AFAE LE+ENA+ +RKQ+L+F+ILK L+  +VEII +GV+E+L D
Sbjct: 60  ITLAELNEKTPADLVAFAEQLEVENASNLRKQDLLFAILKALADEEVEIIADGVLEILPD 119

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS DANYL GPDD+YVSPSQI+ F L++GDTV G++RAPREGERYFALLKV+ IN
Sbjct: 120 GFGFLRSSDANYLPGPDDVYVSPSQIRRFGLRSGDTVHGAVRAPREGERYFALLKVDTIN 179

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
            + PE V+ K+ FDNLTPLYP++R +ME+ +P  KD S RVID++AP+GKGQR LIVAPP
Sbjct: 180 LEDPEMVKTKVLFDNLTPLYPEERLHMEIQDPTLKDRSGRVIDIVAPLGKGQRCLIVAPP 239

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           R GKT++LQNIA SI+KNHPE  LIVLLIDERPEEVTDMQR+V+GEV++STFDE A RHV
Sbjct: 240 RVGKTVMLQNIAKSIEKNHPEVILIVLLIDERPEEVTDMQRTVKGEVVASTFDEPATRHV 299

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
            VAEMVI KAK LVE+  DVVILLDSITRL RAYN  +PSSGK+LTGGVDANALQRPKRF
Sbjct: 300 AVAEMVIEKAKRLVEHKKDVVILLDSITRLGRAYNATVPSSGKVLTGGVDANALQRPKRF 359

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN+++GGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RK+ADKRIFPA+D+
Sbjct: 360 FGAARNVEQGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKVADKRIFPAIDV 419

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           +KSGTRKEDL+  +  L K ++LRRI++ M   DAIEFL+DKL+Q+K+N DFF SMN
Sbjct: 420 LKSGTRKEDLITPKDQLAKTYVLRRILNPMGPQDAIEFLLDKLRQSKNNSDFFQSMN 476


>gi|254460538|ref|ZP_05073954.1| transcription termination factor Rho [Rhodobacterales bacterium
           HTCC2083]
 gi|206677127|gb|EDZ41614.1| transcription termination factor Rho [Rhodobacteraceae bacterium
           HTCC2083]
          Length = 423

 Score =  632 bits (1629), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 300/417 (71%), Positives = 361/417 (86%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           + L +LK +SP  L++ AE LEIENA+ MRK E+MF IL+  +    EI+G+GV+EVLQD
Sbjct: 6   LALAQLKAQSPKNLVSMAEELEIENASTMRKGEMMFQILRERADEGWEIMGDGVLEVLQD 65

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSP+ANYL GPDDIYVSP  I+ +SL+TGDTV+G I AP + +RYFAL+ V  IN
Sbjct: 66  GFGFLRSPEANYLPGPDDIYVSPEMIRKYSLRTGDTVDGVITAPDDNQRYFALINVMQIN 125

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           F+ PE+ ++KI FDNLTPLYPD+RF +E+ +P  KD S+R+IDL+APIGKGQR LIVAPP
Sbjct: 126 FEAPEKTKHKIAFDNLTPLYPDERFKLEIEDPTIKDRSARIIDLVAPIGKGQRCLIVAPP 185

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           RTGKT+LLQNIA SI+ NHPECYLIVLLIDERPEEVTDMQRSV+GEV+SSTFDE A RHV
Sbjct: 186 RTGKTVLLQNIAASIEANHPECYLIVLLIDERPEEVTDMQRSVKGEVVSSTFDEPATRHV 245

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
            V+EMVI KAK LVE+  DVVILLDSITRL RA+N ++PSSGK+LTGGVDANALQRPKRF
Sbjct: 246 AVSEMVIEKAKRLVEHKRDVVILLDSITRLGRAFNTVVPSSGKVLTGGVDANALQRPKRF 305

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RKI+DKR++PA+DI
Sbjct: 306 FGAARNIEEGGSLTIISTALIDTGSRMDEVIFEEFKGTGNSEIVLDRKISDKRVYPAIDI 365

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           +KSGTRKEDLL+++ D+QK F+LRRI++ M ++DA+EFL+ KLKQTK N +FF SMN
Sbjct: 366 LKSGTRKEDLLIDKVDMQKTFVLRRILNPMGTTDAVEFLLGKLKQTKSNAEFFDSMN 422


>gi|162147052|ref|YP_001601513.1| transcription termination factor Rho [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209544114|ref|YP_002276343.1| transcription termination factor Rho [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|161785629|emb|CAP55200.1| Transcription termination factor rho [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209531791|gb|ACI51728.1| transcription termination factor Rho [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 435

 Score =  629 bits (1623), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 303/434 (69%), Positives = 363/434 (83%), Gaps = 17/434 (3%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK K+P  LLA+AESL+IENA+ +RKQ++MF+ILK L+  D  I GEG +E+L D
Sbjct: 1   MHLAELKAKTPADLLAYAESLQIENASSLRKQDMMFAILKTLADNDQAIHGEGTLEILPD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSP+ANYL GPDDIY+SPSQ++ F L+TGDTVEG IRAPR+GERYFALLKVN IN
Sbjct: 61  GFGFLRSPEANYLPGPDDIYISPSQVRRFGLRTGDTVEGQIRAPRDGERYFALLKVNTIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMEL------NNPEN-----------KDISSRVID 166
           F+ PE VR++I+FDNLTPLYP++R  ME+        PE            KD + RVID
Sbjct: 121 FEPPEAVRHRINFDNLTPLYPERRLKMEVEANAVGGEPEKVEKGKGAKSQPKDFTPRVID 180

Query: 167 LIAPIGKGQRSLIVAPPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSV 226
           L++PIG GQR+LIVAPPRTGKT++LQ+IA SI  NHPE +LIVLLIDERPEEVTDM RSV
Sbjct: 181 LVSPIGMGQRALIVAPPRTGKTVMLQSIASSISANHPEVFLIVLLIDERPEEVTDMARSV 240

Query: 227 QGEVISSTFDESAARHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGK 286
           +GEV+SSTFDE A RHVQV EMV+ KAK LVE+  DVVILLDSITRL RAYN ++PSSGK
Sbjct: 241 RGEVVSSTFDEPATRHVQVTEMVLEKAKRLVEHKRDVVILLDSITRLARAYNTVVPSSGK 300

Query: 287 ILTGGVDANALQRPKRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEI 346
           +LTGGVDANALQRPKRFFGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSE+
Sbjct: 301 VLTGGVDANALQRPKRFFGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEL 360

Query: 347 VLERKIADKRIFPAMDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKL 406
           +L+RK+ADKR FPA+DI KSGTRKE+LLVER +L K+++LRRI++ M + DA++FL+DKL
Sbjct: 361 ILDRKLADKRTFPAIDITKSGTRKEELLVERSELSKMWVLRRILAPMGTMDAMDFLLDKL 420

Query: 407 KQTKDNKDFFYSMN 420
           K +K N+DFF +MN
Sbjct: 421 KYSKTNRDFFDAMN 434


>gi|163742609|ref|ZP_02149995.1| transcription termination factor Rho [Phaeobacter gallaeciensis
           2.10]
 gi|161384194|gb|EDQ08577.1| transcription termination factor Rho [Phaeobacter gallaeciensis
           2.10]
          Length = 402

 Score =  628 bits (1619), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 301/401 (75%), Positives = 349/401 (87%)

Query: 20  FAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQDGFGFLRSPDANYLAGP 79
            AE LEIENA+ MRK E+MF IL+  +    EI G+GV+EVLQDGFGFLRSP+ANYL GP
Sbjct: 1   MAEELEIENASTMRKGEMMFQILRERADEGWEIAGDGVLEVLQDGFGFLRSPEANYLPGP 60

Query: 80  DDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAINFDVPERVRNKIHFDNL 139
           DDIYVSP  I+ ++L+TGDTV+G I++P E ERYFAL  V  INF+ PE+ R+KI FDNL
Sbjct: 61  DDIYVSPDMIRQYALRTGDTVDGQIKSPLENERYFALTNVTKINFEEPEKARHKIAFDNL 120

Query: 140 TPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPPRTGKTILLQNIAHSIK 199
           TPLYPD+R  ME+ +P  KD S+RVIDL++PIGKGQRSLIVAPPRTGKT++LQNIAHSI 
Sbjct: 121 TPLYPDERLKMEIEDPTIKDRSARVIDLVSPIGKGQRSLIVAPPRTGKTVILQNIAHSIA 180

Query: 200 KNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHVQVAEMVIAKAKCLVEY 259
           KNHPECYLIVLLIDERPEEVTDMQRSV+GEV+SSTFDE A RHV V+EMVI KAK LVE+
Sbjct: 181 KNHPECYLIVLLIDERPEEVTDMQRSVKGEVVSSTFDEPATRHVAVSEMVIEKAKRLVEH 240

Query: 260 GLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRFFGAARNIKEGGSLTII 319
             DVVILLDSITRL RA+N ++PSSGK+LTGGVDANALQRPKRFFGAARNI+EGGSLTII
Sbjct: 241 KRDVVILLDSITRLGRAFNTVVPSSGKVLTGGVDANALQRPKRFFGAARNIEEGGSLTII 300

Query: 320 GTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDIIKSGTRKEDLLVERQD 379
            TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RKIADKR+FPA+DI+KSGTRKEDLLV++ D
Sbjct: 301 ATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKIADKRVFPAIDILKSGTRKEDLLVDKGD 360

Query: 380 LQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           L K F+LRRI++ M ++DAIEFL+ KLKQTK N +FF SMN
Sbjct: 361 LAKTFVLRRILNPMGTTDAIEFLLSKLKQTKTNSEFFDSMN 401


>gi|58039531|ref|YP_191495.1| transcription termination factor Rho [Gluconobacter oxydans 621H]
 gi|58001945|gb|AAW60839.1| Transcription termination factor Rho [Gluconobacter oxydans 621H]
          Length = 433

 Score =  627 bits (1618), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 299/432 (69%), Positives = 357/432 (82%), Gaps = 15/432 (3%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK KSP  LLA+AE LEIEN + MRKQ++MF+ILK L+ RD  I GEG +E+L D
Sbjct: 1   MHLAELKKKSPADLLAYAEELEIENVSSMRKQDIMFAILKTLAERDQAIYGEGTLEILPD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSP+ANYL GPDDIY+SP+Q++ F L+ GDTVEG IRAPR+GERYFALLKVN IN
Sbjct: 61  GFGFLRSPEANYLPGPDDIYISPAQVRRFGLRPGDTVEGQIRAPRDGERYFALLKVNTIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPE---------------NKDISSRVIDLI 168
           F+ PE VR +I+FDNLTPLYP++R  ME+   E                +D + RVIDL+
Sbjct: 121 FEAPETVRTRINFDNLTPLYPERRLKMEVEQSEAAVTESSPRGKGKKDQRDYTPRVIDLV 180

Query: 169 APIGKGQRSLIVAPPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQG 228
            PIG GQR+LIVAPPRTGKT++LQ+IA SI  NHPE +LIVLLIDERPEEVTDM RSV+G
Sbjct: 181 TPIGMGQRALIVAPPRTGKTVMLQSIAASISANHPEVFLIVLLIDERPEEVTDMARSVRG 240

Query: 229 EVISSTFDESAARHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKIL 288
           EV+SSTFDE A RHVQV EMV+ KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+L
Sbjct: 241 EVVSSTFDEPATRHVQVTEMVLEKAKRLVEHKRDVVILLDSITRLARAYNTVVPSSGKVL 300

Query: 289 TGGVDANALQRPKRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVL 348
           TGGVDANALQRPKRFFGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGN+E++L
Sbjct: 301 TGGVDANALQRPKRFFGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNAELIL 360

Query: 349 ERKIADKRIFPAMDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQ 408
           +RK+ADKR FPA+DI KSGTRKE+LLV+R +L K+++LRRI++ M + DA++FL+DKLK 
Sbjct: 361 DRKLADKRTFPAIDITKSGTRKEELLVDRAELSKMWVLRRILAPMGTMDAMDFLLDKLKY 420

Query: 409 TKDNKDFFYSMN 420
           +K N DFF +MN
Sbjct: 421 SKSNHDFFEAMN 432


>gi|56552892|ref|YP_163731.1| transcription termination factor Rho [Zymomonas mobilis subsp.
           mobilis ZM4]
 gi|241762343|ref|ZP_04760423.1| transcription termination factor Rho [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
 gi|260753415|ref|YP_003226308.1| transcription termination factor Rho [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
 gi|56544466|gb|AAV90620.1| transcription termination factor Rho [Zymomonas mobilis subsp.
           mobilis ZM4]
 gi|241373137|gb|EER62776.1| transcription termination factor Rho [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
 gi|258552778|gb|ACV75724.1| transcription termination factor Rho [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
          Length = 418

 Score =  625 bits (1613), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 295/417 (70%), Positives = 364/417 (87%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L++LK K+P++L+  AE L IE A+ +RKQ+L+F+ILKV + R  +I+G G IEVL D
Sbjct: 1   MHLKDLKQKTPSELVKMAEELGIEGASTLRKQDLLFAILKVQAERGDQIMGLGTIEVLPD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSP+ANYLAGPDDIYVSP+Q++ F L+TGDTVEG IR P++ ERYFAL K+ ++N
Sbjct: 61  GFGFLRSPEANYLAGPDDIYVSPNQVRKFGLRTGDTVEGEIRGPKDSERYFALTKLISVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           FD P+ VR++++FDNLTPLYP ++ N+++++P NKD S+RVID++AP GKGQRSLIVAPP
Sbjct: 121 FDNPDNVRHRVNFDNLTPLYPSEKLNLDISDPTNKDKSARVIDIVAPQGKGQRSLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           R GKT+LLQNIA +I +NHPE +LIVLLIDERPEEVTDMQRSV+GEVISSTFDE A RHV
Sbjct: 181 RVGKTVLLQNIARAISENHPEVFLIVLLIDERPEEVTDMQRSVKGEVISSTFDEPAQRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDS+TRL RAYN ++PSSGK+LTGGVDANALQRPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSVTRLGRAYNTVVPSSGKVLTGGVDANALQRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSL+II TAL+DTGSRMDEVIFEEFKGTGNSE+VL+RK+ADKRIFPAMD+
Sbjct: 301 FGAARNIEEGGSLSIIATALIDTGSRMDEVIFEEFKGTGNSEVVLDRKVADKRIFPAMDV 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
            KSGTRKE+LLV++  L K+++LRRI+  M + DA+EFL+DK+K +K N+DFF SMN
Sbjct: 361 GKSGTRKEELLVDKDTLSKMWVLRRILMQMGTVDAMEFLLDKMKDSKTNEDFFASMN 417


>gi|103488322|ref|YP_617883.1| transcription termination factor Rho [Sphingopyxis alaskensis
           RB2256]
 gi|98978399|gb|ABF54550.1| transcription termination factor Rho [Sphingopyxis alaskensis
           RB2256]
          Length = 418

 Score =  625 bits (1612), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 299/418 (71%), Positives = 361/418 (86%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L+ELK KSP +L+  AE L +E A+ MRKQ+LMFSILK L+    EIIG G IEVL D
Sbjct: 1   MHLKELKTKSPAQLVEMAEELGVEGASTMRKQDLMFSILKELAEEGEEIIGSGTIEVLPD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
            FGFLRS +ANYLAGPDDIYVSP+Q++ + L+TGDTVEG IRAPR+GERYFAL K+ ++N
Sbjct: 61  SFGFLRSSEANYLAGPDDIYVSPNQVRKYGLRTGDTVEGEIRAPRDGERYFALTKLISVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           FD P+ VR++++FDNLTPLYP+++ +++  +P  KD S+RVIDL++P GKGQR+LIVAPP
Sbjct: 121 FDDPDVVRHRVNFDNLTPLYPNQKLSLDTVDPTVKDKSARVIDLVSPQGKGQRALIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           RTGKT+LLQNIA +I  NHPE YLIVLL+DERPEEVTDMQRSV+GEV+SSTFDE A RHV
Sbjct: 181 RTGKTVLLQNIAKAITDNHPEVYLIVLLVDERPEEVTDMQRSVKGEVVSSTFDEPATRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLGRAYNTVVPSSGKVLTGGVDANALQRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSL+II TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RK+ADKRIFPA+D+
Sbjct: 301 FGAARNIEEGGSLSIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKVADKRIFPALDV 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            KSGTRKE+LLVE+  L K+++LRRI+  M + DA+EFL+DK+K +K N+DFF SMN+
Sbjct: 361 GKSGTRKEELLVEKDKLSKMWVLRRILMQMGTVDAMEFLLDKIKDSKTNEDFFDSMNQ 418


>gi|84684646|ref|ZP_01012547.1| transcription termination factor Rho [Maritimibacter alkaliphilus
           HTCC2654]
 gi|84667625|gb|EAQ14094.1| transcription termination factor Rho [Rhodobacterales bacterium
           HTCC2654]
          Length = 418

 Score =  625 bits (1611), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 302/417 (72%), Positives = 355/417 (85%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L +LK +SP  LLA AE LEIENA+ MRK E+MF IL+  +    EI G+GV+EVLQD
Sbjct: 1   MNLSDLKAQSPKDLLAMAEELEIENASTMRKGEMMFQILQARAEDGWEIGGDGVLEVLQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSP+ANYL GPDDIY+SP  I+  SL+TGDTVEG I AP E E YFA+ +V  IN
Sbjct: 61  GFGFLRSPEANYLPGPDDIYMSPDMIRKHSLRTGDTVEGVIAAPGENENYFAITQVEKIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           F  PE  R+K+ FDNLTPL+PD+R  ME+++P  KD S+R+IDL+APIGKGQRSLIVAPP
Sbjct: 121 FTDPETARHKVAFDNLTPLHPDERLKMEIDDPTIKDRSARIIDLVAPIGKGQRSLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           RTGKT+L+QNIAHSI  NHPE YLIVLLIDERPEEVTDM+RSV GEV++STFDE A+RHV
Sbjct: 181 RTGKTVLMQNIAHSISVNHPEVYLIVLLIDERPEEVTDMKRSVNGEVVASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
            V+EMVI KAK LVE+  DVVILLDSITRL RA+N  +PSSGK+LTGGVDANALQRPKRF
Sbjct: 241 AVSEMVIEKAKRLVEHKRDVVILLDSITRLGRAFNTTVPSSGKVLTGGVDANALQRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSE+VL+RK++DKRIFPA+DI
Sbjct: 301 FGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSELVLDRKVSDKRIFPAIDI 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           +KSGTRKE+LLV+ +DLQK ++LRRI++ M ++DAIEFLI KLKQTK N +FF SMN
Sbjct: 361 LKSGTRKEELLVDSKDLQKTYVLRRILNPMGTTDAIEFLISKLKQTKTNDEFFDSMN 417


>gi|114326723|ref|YP_743880.1| transcription termination factor Rho [Granulibacter bethesdensis
           CGDNIH1]
 gi|114314897|gb|ABI60957.1| transcription termination factor rho [Granulibacter bethesdensis
           CGDNIH1]
          Length = 447

 Score =  624 bits (1609), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 297/425 (69%), Positives = 366/425 (86%), Gaps = 6/425 (1%)

Query: 2   SEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVL 61
           + M L ELK KSP  LL+FAESL+IENA+ +RKQ++MF+ILK L+  D  I GEG +E+L
Sbjct: 22  APMHLAELKAKSPADLLSFAESLQIENASSLRKQDMMFAILKNLAENDQAIHGEGTLEIL 81

Query: 62  QDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNA 121
            DGFGFLRSP+AN+L GPDDIYVSPSQ++ F L+ GDTV G IRAP++GERYFALLK++ 
Sbjct: 82  SDGFGFLRSPEANFLPGPDDIYVSPSQVRRFGLRNGDTVGGQIRAPKDGERYFALLKLDT 141

Query: 122 INFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPEN------KDISSRVIDLIAPIGKGQ 175
           +NF+ PE VR++I+FDNLTPLYPD+R  ME+ N ++      KD + RVIDLIAPIGKGQ
Sbjct: 142 VNFEAPESVRHRINFDNLTPLYPDQRLKMEVENFQSVAKGPGKDCTPRVIDLIAPIGKGQ 201

Query: 176 RSLIVAPPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTF 235
           R+LIVAPPRTGKT++LQNIA +I +NHPE +L+VLLIDERPEEVTDM RSV+GEVI+STF
Sbjct: 202 RALIVAPPRTGKTVMLQNIATAIAENHPEAFLMVLLIDERPEEVTDMARSVKGEVIASTF 261

Query: 236 DESAARHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDAN 295
           DE A RHVQV+EMV+ KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDAN
Sbjct: 262 DEPATRHVQVSEMVLEKAKRLVEHKRDVVILLDSITRLARAYNTVVPSSGKVLTGGVDAN 321

Query: 296 ALQRPKRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADK 355
           ALQRPKRFFGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSE+VL+RK++DK
Sbjct: 322 ALQRPKRFFGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSELVLDRKLSDK 381

Query: 356 RIFPAMDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDF 415
           R FPA+DI KSGTRKE++LV++  L K+++LRRI++ M ++DA++FL+DKLK +K N+DF
Sbjct: 382 RTFPAIDITKSGTRKEEMLVDKATLSKMWVLRRILNPMGTTDAMDFLLDKLKYSKTNQDF 441

Query: 416 FYSMN 420
           F +MN
Sbjct: 442 FDAMN 446


>gi|296114331|ref|ZP_06832985.1| transcription termination factor Rho [Gluconacetobacter hansenii
           ATCC 23769]
 gi|295979092|gb|EFG85816.1| transcription termination factor Rho [Gluconacetobacter hansenii
           ATCC 23769]
          Length = 433

 Score =  622 bits (1605), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 299/432 (69%), Positives = 357/432 (82%), Gaps = 15/432 (3%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK K+P  LLA+AE L IENA+ +RKQELMF+ILK L+  D  I G+G +E+L D
Sbjct: 1   MHLAELKAKTPADLLAYAEGLNIENASSLRKQELMFTILKTLAENDQAIYGDGTLEILSD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSP+ANYL GPDDIY+SPSQ++ F L+TGDTVEG IRAPR+GERYFALLKV+ IN
Sbjct: 61  GFGFLRSPEANYLPGPDDIYISPSQVRRFGLRTGDTVEGQIRAPRDGERYFALLKVDTIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPE---------------NKDISSRVIDLI 168
           F+ PE VR +I+FDNLTPLYP++R  ME+ N                  +D + RVIDL+
Sbjct: 121 FEPPEAVRQRINFDNLTPLYPERRLQMEVENTAVGPAEGSAKGKGKGPARDFTPRVIDLV 180

Query: 169 APIGKGQRSLIVAPPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQG 228
           +PIG GQR+LIVAPPRTGKT++LQ+IA SI  NHPE +LIVLLIDERPEEVTDM RSV+G
Sbjct: 181 SPIGMGQRALIVAPPRTGKTVMLQSIASSISANHPEVFLIVLLIDERPEEVTDMARSVRG 240

Query: 229 EVISSTFDESAARHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKIL 288
           EV+SSTFDE A RHVQV EMV+ KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+L
Sbjct: 241 EVVSSTFDEPATRHVQVTEMVLEKAKRLVEHKRDVVILLDSITRLARAYNTVVPSSGKVL 300

Query: 289 TGGVDANALQRPKRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVL 348
           TGGVDANALQRPKRFFGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSE++L
Sbjct: 301 TGGVDANALQRPKRFFGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSELIL 360

Query: 349 ERKIADKRIFPAMDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQ 408
           +RK+ADKR FPA+DI KSGTRKE+LLV+R DL K+++LRRI++ M +  A++F +DKLK 
Sbjct: 361 DRKLADKRTFPAIDITKSGTRKEELLVDRADLSKMWVLRRILAPMGTMGAMDFQLDKLKY 420

Query: 409 TKDNKDFFYSMN 420
           +K NKDFF +MN
Sbjct: 421 SKTNKDFFDAMN 432


>gi|218681275|ref|ZP_03529172.1| transcription termination factor Rho [Rhizobium etli CIAT 894]
          Length = 358

 Score =  622 bits (1604), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 297/357 (83%), Positives = 330/357 (92%)

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS +ANYL GPDDIY+SPSQI+ FSLKTGDTVEG IR P+EGERYFALLKVN IN
Sbjct: 1   GFGFLRSANANYLPGPDDIYISPSQIRRFSLKTGDTVEGPIRGPKEGERYFALLKVNTIN 60

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           FD PE++R+K+HFDNLTPLYP++RF MEL+ P +KD+S RVIDL+AP+GKGQR LIVAPP
Sbjct: 61  FDDPEKIRHKVHFDNLTPLYPNERFKMELDIPTSKDLSPRVIDLVAPLGKGQRGLIVAPP 120

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           RTGKT+LLQNIAHSI  NHPECYLIVLLIDERPEEVTDMQRSV+GEVISSTFDE A RHV
Sbjct: 121 RTGKTVLLQNIAHSITANHPECYLIVLLIDERPEEVTDMQRSVRGEVISSTFDEPAVRHV 180

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+G DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRPKRF
Sbjct: 181 QVAEMVIEKAKRLVEHGRDVVILLDSITRLGRAYNTVVPSSGKVLTGGVDANALQRPKRF 240

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RK+ADKRIFPAMDI
Sbjct: 241 FGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKVADKRIFPAMDI 300

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           +KSGTRKEDLLV RQDLQK+F+LRRI++ M ++DAIEFLIDKLKQTK+N DFF SMN
Sbjct: 301 LKSGTRKEDLLVPRQDLQKIFVLRRILAPMGTTDAIEFLIDKLKQTKNNPDFFDSMN 357


>gi|114798602|ref|YP_762236.1| transcription termination factor Rho [Hyphomonas neptunium ATCC
           15444]
 gi|114738776|gb|ABI76901.1| transcription termination factor Rho [Hyphomonas neptunium ATCC
           15444]
          Length = 418

 Score =  622 bits (1603), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 291/416 (69%), Positives = 357/416 (85%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L+ELK KSP +LLA+AE LE+ENA+ MR Q+++F+ILK L+  +VEI G+GV+EVL D
Sbjct: 1   MTLRELKAKSPEELLAYAEELEVENASSMRTQDMLFAILKELADSEVEITGQGVLEVLTD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSP++NYL GPDDIYVSP  +K  +++TGDTVEG I AP++ ERYFAL  V+ IN
Sbjct: 61  GFGFLRSPESNYLPGPDDIYVSPEVLKKANIRTGDTVEGPIVAPQDSERYFALTDVSQIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           F+ PE+   K+HFDNLTPLYP++R  ME  +P  KD S RVID+++PIGKGQR+LIVAPP
Sbjct: 121 FEEPEKANKKVHFDNLTPLYPEQRLKMESRDPTKKDRSGRVIDIVSPIGKGQRALIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           RTGKT+L+QNIA +I++NHPECYLIVLLIDERPEEVTDM+R+V+GEV++STFDE A RHV
Sbjct: 181 RTGKTVLMQNIAAAIEENHPECYLIVLLIDERPEEVTDMRRTVKGEVVASTFDEPATRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN  +PSSGK+LTGGVDANALQRPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKRDVVILLDSITRLGRAYNTTVPSSGKVLTGGVDANALQRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++ GGSLTI+ TAL+DTGSRMDEVIFEEFKGTGNSE+VL+RKIADKR FPA+DI
Sbjct: 301 FGAARNVENGGSLTIVATALIDTGSRMDEVIFEEFKGTGNSEVVLDRKIADKRTFPAIDI 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSM 419
           +KSGTRKE+L+     L K+++LRRI+  M ++DA++FL+DKLKQTK N +FF +M
Sbjct: 361 MKSGTRKEELITPHDQLSKIYILRRILGPMGANDAVDFLLDKLKQTKTNDEFFEAM 416


>gi|294010022|ref|YP_003543482.1| transcription termination factor [Sphingobium japonicum UT26S]
 gi|292673352|dbj|BAI94870.1| transcription termination factor [Sphingobium japonicum UT26S]
          Length = 418

 Score =  621 bits (1602), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 294/418 (70%), Positives = 362/418 (86%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L++LK K+P +L+  AE L +E A+ +RKQ+LMF+ILKV +    +I+GEG IEVL D
Sbjct: 1   MHLKDLKKKAPAELVTMAEELGVEGASTLRKQDLMFAILKVEADNGEQIMGEGTIEVLPD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSP+AN+LAGPDDIYVSP+Q++ F L+TGDTVEG IRAP++GERYFAL K+ ++N
Sbjct: 61  GFGFLRSPEANFLAGPDDIYVSPNQVRKFGLRTGDTVEGEIRAPKDGERYFALTKLISVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           FD PE VR++++FDNLTPLYP ++  ++  +P  KD S+RVID+++P GKGQR+LIVAPP
Sbjct: 121 FDDPEVVRHRVNFDNLTPLYPTQKLTLDATDPTVKDKSARVIDIVSPQGKGQRALIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           RTGKT+LLQNIA +I  NHPE +LIVLLIDERPEEVTDMQRSV+GEV+SSTFDE A RHV
Sbjct: 181 RTGKTVLLQNIAKAITDNHPEVFLIVLLIDERPEEVTDMQRSVKGEVVSSTFDEPAQRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLGRAYNTVVPSSGKVLTGGVDANALQRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSL+II TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RK+ADKRIFPA+D+
Sbjct: 301 FGAARNIEEGGSLSIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKVADKRIFPALDV 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            KSGTRKE+LLV++  L K+++LRRI+  M + DA+EFL+DK+K +K N+DFF SMN+
Sbjct: 361 GKSGTRKEELLVDKAKLSKMWVLRRILMQMGTVDAMEFLLDKMKDSKTNEDFFDSMNQ 418


>gi|148555744|ref|YP_001263326.1| transcription termination factor Rho [Sphingomonas wittichii RW1]
 gi|148500934|gb|ABQ69188.1| transcription termination factor Rho [Sphingomonas wittichii RW1]
          Length = 418

 Score =  620 bits (1600), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 297/418 (71%), Positives = 361/418 (86%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L++LK KSP  L++ AE L +E A+ MRKQ+LMF+ILKV +    +I+GEG IEVL D
Sbjct: 1   MHLKDLKKKSPADLVSMAEELGVEGASTMRKQDLMFAILKVEAENGEQIMGEGTIEVLPD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSP+ANYLAGPDDIYVSP+Q++ F L+TGDTVEG IRAP++GERYFAL ++ +IN
Sbjct: 61  GFGFLRSPEANYLAGPDDIYVSPNQVRKFGLRTGDTVEGEIRAPKDGERYFALTRLASIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           FD P+ VR++++FDNLTPLYP+++  ++  +P  KD S+RVID+++P GKGQR+LIVAPP
Sbjct: 121 FDDPDVVRHRVNFDNLTPLYPEEKLRLDTLDPTVKDKSARVIDIVSPQGKGQRALIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           R GKT+LLQNIA +I  NHPE +LIVLLIDERPEEVTDMQRSV GEVISSTFDE A RHV
Sbjct: 181 RVGKTVLLQNIAKAITDNHPEVFLIVLLIDERPEEVTDMQRSVNGEVISSTFDEPAQRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLGRAYNTVVPSSGKVLTGGVDANALQRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSL+II TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RK+ADKRIFPAMD+
Sbjct: 301 FGAARNIEEGGSLSIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKVADKRIFPAMDV 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            KSGTRKE+LLV++  L K+++LRRI+  M + DA+EFL+DK+K +K N+DFF SMN+
Sbjct: 361 GKSGTRKEELLVDKGKLSKMWVLRRILMQMGTVDAMEFLLDKMKDSKTNEDFFDSMNQ 418


>gi|114769772|ref|ZP_01447382.1| transcription termination factor Rho [alpha proteobacterium
           HTCC2255]
 gi|114549477|gb|EAU52359.1| transcription termination factor Rho [alpha proteobacterium
           HTCC2255]
 gi|161170268|gb|ABX59238.1| transcription termination factor [uncultured marine bacterium
           EB000_55B11]
 gi|297183797|gb|ADI19920.1| hypothetical protein [uncultured marine bacterium EB000_55B11]
          Length = 423

 Score =  620 bits (1599), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 296/418 (70%), Positives = 352/418 (84%)

Query: 3   EMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQ 62
           ++ L ELK  S   LL  AE+LEIENA+ MRK E+MF+ILK  S    E+ G+GV+EV+ 
Sbjct: 5   KVNLSELKATSAADLLKVAETLEIENASTMRKGEMMFAILKEKSEDGAEVSGDGVMEVMS 64

Query: 63  DGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAI 122
           DGFGFLRSP ANYL GP+DIYVSP  I+  SL+TGDTVEG I  P E ERYFA+ KV  I
Sbjct: 65  DGFGFLRSPQANYLPGPEDIYVSPQMIRKHSLRTGDTVEGWISQPEESERYFAMTKVTQI 124

Query: 123 NFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAP 182
           NF  PE  ++K+HFDNLTPLYP+KR  ME+ +P  KD ++R+IDL++PIGKGQRSLIVAP
Sbjct: 125 NFSDPEAAKHKVHFDNLTPLYPNKRLKMEIEDPTIKDKTARLIDLVSPIGKGQRSLIVAP 184

Query: 183 PRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARH 242
           PRTGKT++LQNIA S++ NHPEC+LIVLLIDERPEEVTDMQRSV+GEVISSTFDE A RH
Sbjct: 185 PRTGKTVILQNIAKSLEANHPECFLIVLLIDERPEEVTDMQRSVKGEVISSTFDEPATRH 244

Query: 243 VQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKR 302
           V V+EM I KAK LVE+G DVVILLDSITRL RA+N ++PSSGK+LTGGVDANALQRPKR
Sbjct: 245 VAVSEMAIEKAKRLVEHGRDVVILLDSITRLGRAFNTVVPSSGKVLTGGVDANALQRPKR 304

Query: 303 FFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMD 362
           FFGAARNI+EGGSLTII TAL++TGSRMDEVIFEEFKGTGNSE+VL+RK+ADKR+FPA+D
Sbjct: 305 FFGAARNIEEGGSLTIIATALIETGSRMDEVIFEEFKGTGNSEVVLDRKVADKRVFPAID 364

Query: 363 IIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           I+KSGTRKE+LLV+  DL K F+LRRI++ M ++DA+EFL+ KLK TK N +FF SMN
Sbjct: 365 ILKSGTRKEELLVDPTDLAKTFVLRRILNPMGTTDAVEFLLGKLKATKSNSEFFDSMN 422


>gi|326386161|ref|ZP_08207785.1| transcription termination factor Rho [Novosphingobium
           nitrogenifigens DSM 19370]
 gi|326209386|gb|EGD60179.1| transcription termination factor Rho [Novosphingobium
           nitrogenifigens DSM 19370]
          Length = 418

 Score =  619 bits (1596), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 295/418 (70%), Positives = 361/418 (86%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L+ELK K+P +L+A AE L +E A+ MR+Q+LMF+ILK ++    EI+G G IEVL D
Sbjct: 1   MHLKELKKKTPAELVAMAEELGVEGASTMRRQDLMFAILKEVAEDGEEILGIGTIEVLPD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSP+ANYLAGPDDIYVSP+Q++ + L+TGDTVEG IRAP++GERYFA+ ++  +N
Sbjct: 61  GFGFLRSPEANYLAGPDDIYVSPNQVRKWGLRTGDTVEGEIRAPKDGERYFAITRLIKVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           FD P+ VR++++FDNLTPLYP++R  ++  +P  KD S+RVIDL++P GKGQR+LIVAPP
Sbjct: 121 FDDPDAVRHRVNFDNLTPLYPNERLRLDTLDPTVKDKSARVIDLVSPQGKGQRALIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           RTGKT+LLQNIA +I  NHPE +LIVLLIDERPEEVTDMQRSV GEVISSTFDE A+RHV
Sbjct: 181 RTGKTVLLQNIAKAITDNHPEVFLIVLLIDERPEEVTDMQRSVNGEVISSTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKRDVVILLDSITRLGRAYNTVVPSSGKVLTGGVDANALQRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSL+II TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RK+ADKRIFPA+D+
Sbjct: 301 FGAARNIEEGGSLSIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKVADKRIFPALDV 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            KSGTRKE+LLV R  L K+++LRRI+  M + DA+EFL+DK+K +K N+DFF +MN+
Sbjct: 361 GKSGTRKEELLVPRDQLTKMWVLRRILMQMGTVDAMEFLLDKMKDSKTNEDFFSTMNQ 418


>gi|307297016|ref|ZP_07576832.1| transcription termination factor Rho [Sphingobium chlorophenolicum
           L-1]
 gi|306877542|gb|EFN08770.1| transcription termination factor Rho [Sphingobium chlorophenolicum
           L-1]
          Length = 418

 Score =  619 bits (1596), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 293/418 (70%), Positives = 361/418 (86%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L++LK K+P  L+  AE L +E A+ +RKQ+LMF+ILKV +    +I+GEG IEVL D
Sbjct: 1   MHLKDLKKKAPADLVTMAEELGVEGASTLRKQDLMFAILKVEAENGEQIMGEGTIEVLPD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSP+AN+LAGPDDIYVSP+Q++ F L+TGDTVEG IRAP++GERYFAL K+ ++N
Sbjct: 61  GFGFLRSPEANFLAGPDDIYVSPNQVRKFGLRTGDTVEGEIRAPKDGERYFALTKLISVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           FD P+ VR++++FDNLTPLYP ++  ++  +P  KD S+RVID+++P GKGQR+LIVAPP
Sbjct: 121 FDDPDVVRHRVNFDNLTPLYPTQKLTLDATDPTVKDKSARVIDIVSPQGKGQRALIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           RTGKT+LLQNIA +I  NHPE +LIVLLIDERPEEVTDMQRSV+GEV+SSTFDE A RHV
Sbjct: 181 RTGKTVLLQNIAKAITDNHPEVFLIVLLIDERPEEVTDMQRSVKGEVVSSTFDEPAQRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLGRAYNTVVPSSGKVLTGGVDANALQRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSL+II TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RK+ADKRIFPA+D+
Sbjct: 301 FGAARNIEEGGSLSIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKVADKRIFPALDV 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            KSGTRKE+LLV++  L K+++LRRI+  M + DA+EFL+DK+K +K N+DFF SMN+
Sbjct: 361 GKSGTRKEELLVDKAKLSKMWVLRRILMQMGTVDAMEFLLDKMKDSKTNEDFFDSMNQ 418


>gi|87198146|ref|YP_495403.1| transcription termination factor Rho [Novosphingobium
           aromaticivorans DSM 12444]
 gi|87133827|gb|ABD24569.1| transcription termination factor Rho [Novosphingobium
           aromaticivorans DSM 12444]
          Length = 418

 Score =  618 bits (1593), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 291/418 (69%), Positives = 362/418 (86%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L++LK K+P +L+  AE LE+E A+ MR+Q+LMF+ILK ++    EI+G G IEVL D
Sbjct: 1   MHLKDLKKKTPAELVQMAEELEVEGASTMRRQDLMFAILKEMAEDGEEILGIGTIEVLPD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSP+ANYLAGPDDIYVSP+Q++ + L+TGDTVEG +RAP++GERYFA+ ++  +N
Sbjct: 61  GFGFLRSPEANYLAGPDDIYVSPNQVRKWGLRTGDTVEGEVRAPKDGERYFAITRLIKVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           FD PE VR++++FDNLTPLYP++R  ++  +P  KD S+RVIDL++P GKGQR+LIVAPP
Sbjct: 121 FDDPEAVRHRVNFDNLTPLYPNERLKLDTLDPTVKDKSARVIDLVSPQGKGQRALIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           RTGKT+LLQN+A +I  NHPE +LIVLL+DERPEEVTDMQRSV+GEVISSTFDE A+RHV
Sbjct: 181 RTGKTVLLQNMAKAITDNHPEVFLIVLLVDERPEEVTDMQRSVKGEVISSTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKRDVVILLDSITRLGRAYNTVVPSSGKVLTGGVDANALQRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSL+II TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RK+ADKRIFPA+D+
Sbjct: 301 FGAARNIEEGGSLSIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKVADKRIFPALDV 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            KSGTRKE+LLV +  L K+++LRRI+  M + DA+EFL+DK+K +K N+DFF +MN+
Sbjct: 361 GKSGTRKEELLVPKDQLSKMWVLRRILMQMGTVDAMEFLLDKMKDSKTNEDFFATMNQ 418


>gi|296284836|ref|ZP_06862834.1| transcription termination factor Rho [Citromicrobium bathyomarinum
           JL354]
          Length = 421

 Score =  616 bits (1589), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 295/421 (70%), Positives = 360/421 (85%), Gaps = 3/421 (0%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLS---GRDVEIIGEGVIEV 60
           M L++LK K+P  L++ AE L +E A  MR+Q+LMF IL+ L+     D +I+G G IEV
Sbjct: 1   MHLKDLKKKAPADLVSMAEELGVEAAGTMRRQDLMFCILRELAEDEDYDEQIMGIGTIEV 60

Query: 61  LQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVN 120
           +QDGFGFLRSP+ANYLAGPDDIYVSP+QI+ + L+TGDTVEG IRAPREGERYFAL K+ 
Sbjct: 61  MQDGFGFLRSPEANYLAGPDDIYVSPNQIRKWGLRTGDTVEGEIRAPREGERYFALTKLT 120

Query: 121 AINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIV 180
           ++N+D PE VR + +FDNLTPLYP+++ N++  +P  KD S+RVID+I+P GKGQR+LIV
Sbjct: 121 SVNYDDPEAVRMRTNFDNLTPLYPEQKLNLDTLDPTVKDKSARVIDIISPQGKGQRALIV 180

Query: 181 APPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAA 240
           APPRTGKT+LLQNIA +I  NHPE +L+VLL+DERPEEVTDMQRSV GEVISSTFDE A 
Sbjct: 181 APPRTGKTVLLQNIAKAITDNHPEVFLLVLLVDERPEEVTDMQRSVNGEVISSTFDEPAQ 240

Query: 241 RHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRP 300
           RHVQVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRP
Sbjct: 241 RHVQVAEMVIEKAKRLVEHKKDVVILLDSITRLGRAYNTVVPSSGKVLTGGVDANALQRP 300

Query: 301 KRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPA 360
           KRFFGAARNI+EGGSL+II TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RK+ADKRIFPA
Sbjct: 301 KRFFGAARNIEEGGSLSIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKVADKRIFPA 360

Query: 361 MDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           +D+ KSGTRKE+LLVE+  L K+++LRRI+  M + D++EFL+DK+K +K N+DFF +MN
Sbjct: 361 LDVGKSGTRKEELLVEKDKLSKMWVLRRILMQMGTIDSMEFLLDKMKDSKTNEDFFDTMN 420

Query: 421 K 421
           +
Sbjct: 421 Q 421


>gi|258541407|ref|YP_003186840.1| transcription termination factor Rho [Acetobacter pasteurianus IFO
           3283-01]
 gi|256632485|dbj|BAH98460.1| transcription termination factor Rho [Acetobacter pasteurianus IFO
           3283-01]
 gi|256635542|dbj|BAI01511.1| transcription termination factor Rho [Acetobacter pasteurianus IFO
           3283-03]
 gi|256638597|dbj|BAI04559.1| transcription termination factor Rho [Acetobacter pasteurianus IFO
           3283-07]
 gi|256641651|dbj|BAI07606.1| transcription termination factor Rho [Acetobacter pasteurianus IFO
           3283-22]
 gi|256644706|dbj|BAI10654.1| transcription termination factor Rho [Acetobacter pasteurianus IFO
           3283-26]
 gi|256647761|dbj|BAI13702.1| transcription termination factor Rho [Acetobacter pasteurianus IFO
           3283-32]
 gi|256650814|dbj|BAI16748.1| transcription termination factor Rho [Acetobacter pasteurianus IFO
           3283-01-42C]
 gi|256653805|dbj|BAI19732.1| transcription termination factor Rho [Acetobacter pasteurianus IFO
           3283-12]
          Length = 432

 Score =  615 bits (1587), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 294/431 (68%), Positives = 359/431 (83%), Gaps = 14/431 (3%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK KSP  LLA AE L IENA+ +RKQ++MF+ILK L+  D  I GEG +E++ D
Sbjct: 1   MHLAELKAKSPADLLACAEDLNIENASSLRKQDMMFAILKALADNDQAIYGEGTLEIMHD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFG+LRSP++NYL GPDDIY+SP+Q++ F L+TGDTVEG IRAPR+GERYF++LK+N IN
Sbjct: 61  GFGYLRSPESNYLPGPDDIYISPTQVRRFGLRTGDTVEGQIRAPRDGERYFSMLKINTIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNN----PE----------NKDISSRVIDLIA 169
           F+ P+ VR++I+FDNLTPLYP++R  ME+ +    PE           KD + RVIDL++
Sbjct: 121 FEPPDAVRHRINFDNLTPLYPERRLQMEVESQATAPEPKAEKGKKGAQKDFTPRVIDLVS 180

Query: 170 PIGKGQRSLIVAPPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGE 229
           PIG GQR+LIVAPPR+GKT++LQ+IA SI  NHPE +LIVLLIDERPEEVTDM RSV+GE
Sbjct: 181 PIGMGQRALIVAPPRSGKTVMLQSIASSISANHPEVFLIVLLIDERPEEVTDMARSVRGE 240

Query: 230 VISSTFDESAARHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILT 289
           VI+STFDE A RHVQV EMV+ KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LT
Sbjct: 241 VIASTFDEPAHRHVQVTEMVLEKAKRLVEHKRDVVILLDSITRLARAYNTVVPSSGKVLT 300

Query: 290 GGVDANALQRPKRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLE 349
           GGVDANALQRPKRFFGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSE+VL+
Sbjct: 301 GGVDANALQRPKRFFGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSELVLD 360

Query: 350 RKIADKRIFPAMDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQT 409
           RK+ADKR FPA+DI KSGTRKE+LLV+R  L K+++LRRI++ M + DA++FL+DKLK +
Sbjct: 361 RKLADKRTFPAIDITKSGTRKEELLVDRATLSKMWVLRRILAPMGTMDAMDFLLDKLKYS 420

Query: 410 KDNKDFFYSMN 420
           K N DFF +MN
Sbjct: 421 KTNNDFFEAMN 431


>gi|296533448|ref|ZP_06896031.1| transcription termination factor Rho [Roseomonas cervicalis ATCC
           49957]
 gi|296266228|gb|EFH12270.1| transcription termination factor Rho [Roseomonas cervicalis ATCC
           49957]
          Length = 424

 Score =  615 bits (1587), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 291/423 (68%), Positives = 361/423 (85%), Gaps = 6/423 (1%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK KSP  LLAFAESL+IENA+ +RKQ++MF+ILK L+  +  I G+G +E+L D
Sbjct: 1   MHLSELKAKSPADLLAFAESLQIENASTLRKQDMMFAILKQLAENEQAIHGDGTLEILPD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSP +NYL GPDDIYVSP+Q++ F L+TGDTVEG IRAP++GERYFALLK+N +N
Sbjct: 61  GFGFLRSPQSNYLPGPDDIYVSPAQVRRFGLRTGDTVEGQIRAPKDGERYFALLKINTVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPEN------KDISSRVIDLIAPIGKGQRS 177
           F+ PE +R++I+FDNLTPLYP +R  ME +  E+      KD + RVIDL+APIG GQR+
Sbjct: 121 FEPPEALRHRINFDNLTPLYPTRRLKMENSEFESVAKGMQKDYTPRVIDLVAPIGMGQRA 180

Query: 178 LIVAPPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDE 237
           L+VAPPRTGKT++LQNIA SI  NHP+ +L+VLLIDERPEEVTDM R+V+GEV++STFDE
Sbjct: 181 LVVAPPRTGKTVMLQNIARSISLNHPDVFLLVLLIDERPEEVTDMARTVRGEVVASTFDE 240

Query: 238 SAARHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANAL 297
            A RHVQV EMV+ KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANAL
Sbjct: 241 PATRHVQVTEMVLEKAKRLVEHKRDVVILLDSITRLGRAYNSVVPSSGKVLTGGVDANAL 300

Query: 298 QRPKRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRI 357
           QRPKRFFGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSE++L+RK++DKR+
Sbjct: 301 QRPKRFFGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSELILDRKLSDKRV 360

Query: 358 FPAMDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFY 417
           FPA+DI KSGTRKE++L++R  L K+++LRRI++ M + DA+EFL+DKLK +K N+DFF 
Sbjct: 361 FPAIDITKSGTRKEEVLIDRATLTKMWVLRRILNPMGTQDAMEFLLDKLKYSKTNQDFFD 420

Query: 418 SMN 420
           +MN
Sbjct: 421 AMN 423


>gi|148260229|ref|YP_001234356.1| transcription termination factor Rho [Acidiphilium cryptum JF-5]
 gi|326403415|ref|YP_004283496.1| transcription termination factor Rho [Acidiphilium multivorum
           AIU301]
 gi|146401910|gb|ABQ30437.1| transcription termination factor Rho [Acidiphilium cryptum JF-5]
 gi|325050276|dbj|BAJ80614.1| transcription termination factor Rho [Acidiphilium multivorum
           AIU301]
          Length = 424

 Score =  615 bits (1586), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 291/423 (68%), Positives = 357/423 (84%), Gaps = 6/423 (1%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           MKL ELK KSPT LL+ AE L++ENA+ +RKQ++MF+ILK  +  D  I G+G +E L D
Sbjct: 1   MKLAELKAKSPTDLLSLAEELQVENASSLRKQDMMFAILKAYAENDQAIHGDGTLETLPD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSP +NYL GPDDIYVSP+QI+ F L+TGDTV G IRAP+EGERYF+L KV+ IN
Sbjct: 61  GFGFLRSPQSNYLPGPDDIYVSPAQIRRFGLRTGDTVAGEIRAPKEGERYFSLQKVDTIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNP------ENKDISSRVIDLIAPIGKGQRS 177
           F+ P+ VR++I+FDNLTPLYP++R  ME+ +       + KD ++RV+DLIAPIGKGQR+
Sbjct: 121 FEAPDAVRHRINFDNLTPLYPNQRLQMEIEDAPPPPKGQQKDYTARVMDLIAPIGKGQRA 180

Query: 178 LIVAPPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDE 237
           LIVAPPRTGKT++LQ+IA SI  NHPE +LIVLLIDERPEEVTDM R+V+GEV++STFDE
Sbjct: 181 LIVAPPRTGKTVMLQSIATSISANHPEAFLIVLLIDERPEEVTDMARTVKGEVVASTFDE 240

Query: 238 SAARHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANAL 297
            A RHVQV EMV+ KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANAL
Sbjct: 241 PATRHVQVTEMVLEKAKRLVEHKRDVVILLDSITRLARAYNAVVPSSGKVLTGGVDANAL 300

Query: 298 QRPKRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRI 357
           Q+PKRFFGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSE++L+RK++DKR 
Sbjct: 301 QKPKRFFGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSELILDRKLSDKRT 360

Query: 358 FPAMDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFY 417
           FPA+DI KSGTRKE+LLVER  L K+++LRRI++ M   +A++FL+DKLK +K N DFF 
Sbjct: 361 FPAIDITKSGTRKEELLVERATLSKMWVLRRILNPMGPGEAMDFLLDKLKYSKTNNDFFE 420

Query: 418 SMN 420
           +MN
Sbjct: 421 AMN 423


>gi|15892682|ref|NP_360396.1| transcription termination factor Rho [Rickettsia conorii str.
           Malish 7]
 gi|34581631|ref|ZP_00143111.1| transcription termination factor [Rickettsia sibirica 246]
 gi|157828571|ref|YP_001494813.1| transcription termination factor Rho [Rickettsia rickettsii str.
           'Sheila Smith']
 gi|165933285|ref|YP_001650074.1| transcription termination factor Rho [Rickettsia rickettsii str.
           Iowa]
 gi|229586787|ref|YP_002845288.1| transcription termination factor Rho [Rickettsia africae ESF-5]
 gi|81854101|sp|Q92HL2|RHO_RICCN RecName: Full=Transcription termination factor Rho; AltName:
           Full=ATP-dependent helicase Rho
 gi|15619855|gb|AAL03297.1| transcription termination factor [Rickettsia conorii str. Malish 7]
 gi|28263016|gb|EAA26520.1| transcription termination factor [Rickettsia sibirica 246]
 gi|157801052|gb|ABV76305.1| transcription termination factor Rho [Rickettsia rickettsii str.
           'Sheila Smith']
 gi|165908372|gb|ABY72668.1| transcription termination factor rho [Rickettsia rickettsii str.
           Iowa]
 gi|228021837|gb|ACP53545.1| Transcription termination factor [Rickettsia africae ESF-5]
          Length = 458

 Score =  614 bits (1584), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 297/418 (71%), Positives = 361/418 (86%), Gaps = 2/418 (0%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           + L++LK K P +L A AE L+IEN N + KQEL+F+ILK    + V I+GEGV+EVL D
Sbjct: 31  INLKQLKRKLPEELQAQAEELKIENINSLLKQELVFAILKKSVEQGVLIVGEGVLEVLPD 90

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSP+ NYLAGPDDIY+SPSQI+ F L+TGDTVEG IRAP+ GERYFALLKVN +N
Sbjct: 91  GFGFLRSPEVNYLAGPDDIYISPSQIRRFGLRTGDTVEGQIRAPKAGERYFALLKVNRVN 150

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMEL--NNPENKDISSRVIDLIAPIGKGQRSLIVA 181
           F+ P +  +++HFDNLTPLYPD++  +EL  N+ ++KD S+RVI+L+AP+GKGQR+LIVA
Sbjct: 151 FEDPSKAYHRVHFDNLTPLYPDEKLGLELENNSKDSKDFSTRVIELVAPMGKGQRALIVA 210

Query: 182 PPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAAR 241
           PPRTGKT+LLQNIAH+I  N+PE +LIVLLIDERPEEVTDMQRSV+GEV+SSTFDE A+R
Sbjct: 211 PPRTGKTVLLQNIAHAITTNNPEVFLIVLLIDERPEEVTDMQRSVRGEVVSSTFDEPASR 270

Query: 242 HVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPK 301
           HVQ+AEMVI KAK LVE+  DVVIL+D+ITRL RAYN ++PSSGK+LTGGVDANALQRPK
Sbjct: 271 HVQLAEMVIKKAKRLVEHKKDVVILVDAITRLARAYNTVVPSSGKVLTGGVDANALQRPK 330

Query: 302 RFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAM 361
           RFFGAARNI+ GGSLTIIGTAL++TGSRMDEVIFEEFKGTGNSEIVL+RKIADKRI+PA+
Sbjct: 331 RFFGAARNIENGGSLTIIGTALIETGSRMDEVIFEEFKGTGNSEIVLDRKIADKRIYPAI 390

Query: 362 DIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSM 419
           DI +SGTRKEDLLV++  L K+++LRRI+  M SS+AIEFL+ KL+ TK N +FF  M
Sbjct: 391 DITRSGTRKEDLLVDKIILNKMWVLRRIIDPMGSSEAIEFLLKKLENTKTNGEFFEMM 448


>gi|238650225|ref|YP_002916076.1| transcription termination factor Rho [Rickettsia peacockii str.
           Rustic]
 gi|238624323|gb|ACR47029.1| transcription termination factor Rho [Rickettsia peacockii str.
           Rustic]
          Length = 458

 Score =  614 bits (1584), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 297/418 (71%), Positives = 361/418 (86%), Gaps = 2/418 (0%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           + L++LK K P +L A AE L+IEN N + KQEL+F+ILK    + V I+GEGV+EVL D
Sbjct: 31  INLKQLKRKLPEELQAQAEELKIENINSLLKQELVFAILKKSVEQGVLIVGEGVLEVLPD 90

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSP+ NYLAGPDDIY+SPSQI+ F L+TGDTVEG IRAP+ GERYFALLKVN +N
Sbjct: 91  GFGFLRSPEVNYLAGPDDIYISPSQIRRFGLRTGDTVEGQIRAPKAGERYFALLKVNRVN 150

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMEL--NNPENKDISSRVIDLIAPIGKGQRSLIVA 181
           F+ P +  +++HFDNLTPLYPD++  +EL  N+ ++KD S+RVI+L+AP+GKGQR+LIVA
Sbjct: 151 FEDPSKAYHRVHFDNLTPLYPDEKLGLELENNSKDSKDFSTRVIELVAPMGKGQRALIVA 210

Query: 182 PPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAAR 241
           PPRTGKT+LLQNIAH+I  N+PE +LIVLLIDERPEEVTDMQRSV+GEV+SSTFDE A+R
Sbjct: 211 PPRTGKTVLLQNIAHAITTNNPEVFLIVLLIDERPEEVTDMQRSVRGEVVSSTFDEPASR 270

Query: 242 HVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPK 301
           HVQ+AEMVI KAK LVE+  DVVIL+D+ITRL RAYN ++PSSGK+LTGGVDANALQRPK
Sbjct: 271 HVQLAEMVIKKAKRLVEHKKDVVILVDAITRLARAYNTVVPSSGKVLTGGVDANALQRPK 330

Query: 302 RFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAM 361
           RFFGAARNI+ GGSLTIIGTAL++TGSRMDEVIFEEFKGTGNSEIVL+RKIADKRI+PA+
Sbjct: 331 RFFGAARNIENGGSLTIIGTALIETGSRMDEVIFEEFKGTGNSEIVLDRKIADKRIYPAI 390

Query: 362 DIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSM 419
           DI +SGTRKEDLLV++  L K+++LRRI+  M SS+AIEFL+ KL+ TK N +FF  M
Sbjct: 391 DITRSGTRKEDLLVDKIILNKMWVLRRIIDPMGSSEAIEFLLKKLENTKTNGEFFEMM 448


>gi|262277824|ref|ZP_06055617.1| transcription termination factor Rho [alpha proteobacterium
           HIMB114]
 gi|262224927|gb|EEY75386.1| transcription termination factor Rho [alpha proteobacterium
           HIMB114]
          Length = 422

 Score =  613 bits (1582), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 296/421 (70%), Positives = 359/421 (85%), Gaps = 3/421 (0%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M LQELK+KSP  L++ AE L IEN + +RKQE++F+ILK L+ +  +I   GV+E LQD
Sbjct: 1   MNLQELKDKSPADLISEAEKLGIENPSTLRKQEILFAILKKLAEKGEQITATGVLETLQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLR+ ++NYL GPDDIYVSPSQI+ F L+ GDTVEG IRAP++ ERYFALLKVN IN
Sbjct: 61  GFGFLRAMESNYLPGPDDIYVSPSQIRRFGLRKGDTVEGEIRAPKDQERYFALLKVNKIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPE---NKDISSRVIDLIAPIGKGQRSLIV 180
           F+ PE+ ++KI+FDNLTPLYPD++  +E+   +     D+++RVIDL++PIGKGQRSLIV
Sbjct: 121 FEDPEKTKHKINFDNLTPLYPDEKIKLEIEKTKIEKKTDVTARVIDLVSPIGKGQRSLIV 180

Query: 181 APPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAA 240
           APPRTGKT++LQNIA+SI  NHPE YLIVLLIDERPEEVTDMQR+V GEV+SSTFDE A 
Sbjct: 181 APPRTGKTVILQNIANSITANHPEIYLIVLLIDERPEEVTDMQRTVNGEVVSSTFDEPAQ 240

Query: 241 RHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRP 300
           RHVQVAEMVI KAK L E+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRP
Sbjct: 241 RHVQVAEMVIEKAKRLCEHKKDVVILLDSITRLGRAYNAVVPSSGKVLTGGVDANALQRP 300

Query: 301 KRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPA 360
           KRFFGAARNI+EGGSLTII TAL++TGSRMDEVIFEEFKGTGNSE+VL+RK+ADKR +PA
Sbjct: 301 KRFFGAARNIEEGGSLTIISTALIETGSRMDEVIFEEFKGTGNSEVVLDRKVADKRTYPA 360

Query: 361 MDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           +D+ KSGTRKE+LL E+ +L K+ +LRRI++ M S DAIEFLI KL++TK+N +FF SMN
Sbjct: 361 IDVAKSGTRKEELLFEKDELSKMNVLRRIINPMGSMDAIEFLIGKLRETKNNGEFFDSMN 420

Query: 421 K 421
           K
Sbjct: 421 K 421


>gi|91205552|ref|YP_537907.1| transcription termination factor Rho [Rickettsia bellii RML369-C]
 gi|157827268|ref|YP_001496332.1| transcription termination factor Rho [Rickettsia bellii OSU 85-389]
 gi|122425609|sp|Q1RIJ6|RHO_RICBR RecName: Full=Transcription termination factor Rho; AltName:
           Full=ATP-dependent helicase Rho
 gi|91069096|gb|ABE04818.1| Transcription termination factor [Rickettsia bellii RML369-C]
 gi|157802572|gb|ABV79295.1| transcription termination factor Rho [Rickettsia bellii OSU 85-389]
          Length = 449

 Score =  613 bits (1580), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 296/416 (71%), Positives = 360/416 (86%), Gaps = 1/416 (0%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           + L+ELK K P +L A AE L+IEN + +RKQEL+F+ILK    +   I+GEGV+EVL D
Sbjct: 28  INLKELKRKLPEELQAQAEELKIENVSSLRKQELVFAILKKSVEQGGSIVGEGVLEVLPD 87

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSP+ NYLAGPDDIY+SPSQI+ F L+TGDTVEG IRAP+EGERYFALLKVN +N
Sbjct: 88  GFGFLRSPEVNYLAGPDDIYISPSQIRRFGLRTGDTVEGRIRAPKEGERYFALLKVNKVN 147

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           F+ P +  ++++FDNLTPLYPD++  +EL +  +KD S+RVI+L+AP+GKGQR+LIVAPP
Sbjct: 148 FEDPSKAYHRVNFDNLTPLYPDEKLGLELED-NSKDFSTRVIELVAPMGKGQRALIVAPP 206

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           RTGKT+LLQNIAH+I  N+PE +LIVLLIDERPEEVTDMQRSV+GEV+SSTFDE A+RHV
Sbjct: 207 RTGKTVLLQNIAHAITTNNPEVFLIVLLIDERPEEVTDMQRSVRGEVVSSTFDEPASRHV 266

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           Q+AEMVI KAK LVE+  DVVIL+D+ITRL RAYN ++PSSGK+LTGGVDANALQRPKRF
Sbjct: 267 QLAEMVIEKAKRLVEHKKDVVILVDAITRLARAYNTVVPSSGKVLTGGVDANALQRPKRF 326

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+ GGSLTIIGTAL++TGSRMDEVIFEEFKGTGNSEIVL+RKIADKRI+PA+DI
Sbjct: 327 FGAARNIENGGSLTIIGTALIETGSRMDEVIFEEFKGTGNSEIVLDRKIADKRIYPAIDI 386

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSM 419
            +SGTRKEDLLV++  L K+++LRRI+  M SS+AIEFL+ KL+ TK N +FF  M
Sbjct: 387 TRSGTRKEDLLVDKIVLNKMWVLRRIIDPMGSSEAIEFLLKKLEHTKTNNEFFEMM 442


>gi|332186940|ref|ZP_08388681.1| transcription termination factor Rho [Sphingomonas sp. S17]
 gi|332012950|gb|EGI55014.1| transcription termination factor Rho [Sphingomonas sp. S17]
          Length = 418

 Score =  612 bits (1579), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 290/418 (69%), Positives = 360/418 (86%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L++LK K+P  L+  AE L +E+A+ +RKQ+L+F+ILK  + +  +I+G G IEVL D
Sbjct: 1   MHLKDLKKKTPADLVQLAEELGVESASTLRKQDLLFAILKEQAEQGDQIMGLGTIEVLPD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSP+ANYLAGPDDIYVSP+Q++   L+TGDTVEG IRAP++GERYFAL K+ ++N
Sbjct: 61  GFGFLRSPEANYLAGPDDIYVSPNQVRKHGLRTGDTVEGEIRAPKDGERYFALTKLTSVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           FD PE VR++++FDNLTPLYP+++  ++  +P  KD S+RVID+++P GKGQR+LIVAPP
Sbjct: 121 FDDPEAVRHRVNFDNLTPLYPEQKLILDPADPTQKDKSARVIDIVSPQGKGQRTLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           R GKT++LQNIA +I  NHPE +LIVLLIDERPEEVTDMQRSV+GEV+SSTFDE A RHV
Sbjct: 181 RVGKTVMLQNIAKAITDNHPEVFLIVLLIDERPEEVTDMQRSVRGEVVSSTFDEPAQRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLGRAYNTVVPSSGKVLTGGVDANALQRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSL+II TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RK+ADKRIFPAMD+
Sbjct: 301 FGAARNIEEGGSLSIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKVADKRIFPAMDV 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            KSGTRKE+LLVE+  L K+++LRRI+  M + D++EFL+DK+K +K N+DFF SMN+
Sbjct: 361 GKSGTRKEELLVEKDKLSKMWVLRRILMQMGTIDSMEFLLDKMKNSKTNEDFFDSMNQ 418


>gi|94496569|ref|ZP_01303145.1| transcription termination factor Rho [Sphingomonas sp. SKA58]
 gi|94423929|gb|EAT08954.1| transcription termination factor Rho [Sphingomonas sp. SKA58]
          Length = 418

 Score =  612 bits (1579), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 289/418 (69%), Positives = 357/418 (85%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L++LK   P  L+  AE L +E A+ +RKQ+LMF+ILK  +    +I+GEG IEVL D
Sbjct: 1   MHLKDLKKTVPADLVTMAEELGVEGASTLRKQDLMFAILKAEAENGEQIMGEGTIEVLPD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSP+AN+LAGPDDIYVSP+Q++ F L+TGDTVEG IRAP++GERYFAL K+  +N
Sbjct: 61  GFGFLRSPEANFLAGPDDIYVSPNQVRKFGLRTGDTVEGEIRAPKDGERYFALTKLTTVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           FD P+ VR++++FDNLTPLYPD++  ++  +P  KD S+RVID+++P GKGQR+LIVAPP
Sbjct: 121 FDDPDVVRHRVNFDNLTPLYPDEKLRLDTLDPTVKDKSARVIDIVSPQGKGQRTLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           R GKT++LQNIA +I  NHPE +LIVLLIDERPEEVTDMQRSV+GEV+SSTFDE A RHV
Sbjct: 181 RVGKTVMLQNIAKAITDNHPEVFLIVLLIDERPEEVTDMQRSVKGEVVSSTFDEPATRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLGRAYNTVVPSSGKVLTGGVDANALQRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSL+II TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RK+ADKRIFPA+D+
Sbjct: 301 FGAARNIEEGGSLSIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKVADKRIFPALDV 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            KSGTRKE+LLV++  L K+++LRRI+  M + DA+EFL+DK+K +K N+DFF +MN+
Sbjct: 361 GKSGTRKEELLVDKPTLSKMWVLRRILMQMGTIDAMEFLLDKMKDSKTNEDFFATMNQ 418


>gi|85375430|ref|YP_459492.1| transcription termination factor Rho [Erythrobacter litoralis
           HTCC2594]
 gi|84788513|gb|ABC64695.1| transcription termination factor Rho [Erythrobacter litoralis
           HTCC2594]
          Length = 421

 Score =  612 bits (1577), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 294/421 (69%), Positives = 361/421 (85%), Gaps = 3/421 (0%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDV---EIIGEGVIEV 60
           M L++LK K+P +L++ AE L +E A+ MR+Q+L+FSIL+ L+  +    +I+G G IEV
Sbjct: 1   MHLRDLKEKTPAELVSMAEELGVEGASTMRRQDLLFSILRELAEDEEYEEQIMGIGTIEV 60

Query: 61  LQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVN 120
           LQDGFGFLRSP+ANYLAGPDDIYVSP+QI+ + L+TGDTVEG IRAP EGERYFAL  + 
Sbjct: 61  LQDGFGFLRSPEANYLAGPDDIYVSPNQIRKWGLRTGDTVEGEIRAPNEGERYFALTSLK 120

Query: 121 AINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIV 180
            +NFD P+ VR + +FDNLTPLYPD++ +++  +P  KD S+RVID+I+P GKGQR+LIV
Sbjct: 121 TVNFDEPDAVRRRTNFDNLTPLYPDQKLSLDTLDPTVKDKSARVIDIISPQGKGQRALIV 180

Query: 181 APPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAA 240
           APPRTGKT+LLQNIA +I  NHPE +L+VLL+DERPEEVTDMQRSV+GEVISSTFDE A 
Sbjct: 181 APPRTGKTVLLQNIAKAITDNHPEVFLLVLLVDERPEEVTDMQRSVKGEVISSTFDEPAN 240

Query: 241 RHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRP 300
           RHVQVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRP
Sbjct: 241 RHVQVAEMVIEKAKRLVEHKHDVVILLDSITRLGRAYNTVVPSSGKVLTGGVDANALQRP 300

Query: 301 KRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPA 360
           KRFFGAARNI+EGGSL+II TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RK+ADKRIFPA
Sbjct: 301 KRFFGAARNIEEGGSLSIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKVADKRIFPA 360

Query: 361 MDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           +D+ KSGTRKE+LLVE+  L K+++LRRI+  M + DA+EFL+DK+K +K N+DFF +MN
Sbjct: 361 LDVGKSGTRKEELLVEKDKLSKMWVLRRILMQMGTIDAMEFLLDKMKDSKTNEDFFETMN 420

Query: 421 K 421
           +
Sbjct: 421 Q 421


>gi|157825820|ref|YP_001493540.1| transcription termination factor Rho [Rickettsia akari str.
           Hartford]
 gi|157799778|gb|ABV75032.1| transcription termination factor Rho [Rickettsia akari str.
           Hartford]
          Length = 458

 Score =  611 bits (1576), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 295/418 (70%), Positives = 361/418 (86%), Gaps = 2/418 (0%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           + L++LK K P +L A AE+L+IEN N + KQEL+F+IL+    +   I+GEGV+EVL D
Sbjct: 31  INLKQLKRKLPEELQAQAEALKIENINSLLKQELVFAILQKSVEQGGLIVGEGVLEVLPD 90

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSP+ NYLAGPDDIY+SPSQI+ F L+TGDTVEG IRAP+ GERYFALLKVN +N
Sbjct: 91  GFGFLRSPEVNYLAGPDDIYISPSQIRRFGLRTGDTVEGQIRAPKAGERYFALLKVNRVN 150

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMEL--NNPENKDISSRVIDLIAPIGKGQRSLIVA 181
           F+ P +  +++HFDNLTPLYPD++  +EL  N+ ++KD S+RVI+L+AP+GKGQR+LIVA
Sbjct: 151 FEDPSKAYHRVHFDNLTPLYPDEKLGLELENNSKDSKDFSTRVIELVAPMGKGQRALIVA 210

Query: 182 PPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAAR 241
           PPRTGKT+LLQNIAH+I  N+PE +LIVLLIDERPEEVTDMQRSV+GEV+SSTFDE A+R
Sbjct: 211 PPRTGKTVLLQNIAHAITTNNPEVFLIVLLIDERPEEVTDMQRSVRGEVVSSTFDEPASR 270

Query: 242 HVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPK 301
           HVQ+AEMVI KAK LVE+  DVVIL+D+ITRL RAYN ++PSSGK+LTGGVDANALQRPK
Sbjct: 271 HVQLAEMVIEKAKRLVEHKKDVVILVDAITRLARAYNTVVPSSGKVLTGGVDANALQRPK 330

Query: 302 RFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAM 361
           RFFGAARNI+ GGSLTIIGTAL++TGSRMDEVIFEEFKGTGNSEIVL+RKIADKRI+PA+
Sbjct: 331 RFFGAARNIENGGSLTIIGTALIETGSRMDEVIFEEFKGTGNSEIVLDRKIADKRIYPAI 390

Query: 362 DIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSM 419
           DI +SGTRKEDLLV++  L K+++LRRI+  M SS+A+EFL+ KLK TK N +FF  M
Sbjct: 391 DITRSGTRKEDLLVDKIILNKMWVLRRIIDPMGSSEAMEFLLKKLKNTKTNNEFFEMM 448


>gi|67459157|ref|YP_246781.1| transcription termination factor Rho [Rickettsia felis URRWXCal2]
 gi|75536411|sp|Q4ULF7|RHO_RICFE RecName: Full=Transcription termination factor Rho; AltName:
           Full=ATP-dependent helicase Rho
 gi|67004690|gb|AAY61616.1| Transcription termination factor [Rickettsia felis URRWXCal2]
          Length = 458

 Score =  611 bits (1576), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 296/418 (70%), Positives = 360/418 (86%), Gaps = 2/418 (0%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           + L++LK K P +L A AE L+IEN N + KQEL+F+ILK    +   I+GEGV+EVL D
Sbjct: 31  INLKQLKRKLPEELQAQAEELKIENINSLLKQELVFAILKKSVEQGGLIVGEGVLEVLPD 90

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSP+ NYLAGPDDIY+SPSQI+ F L+TGDTVEG IRAP+ GERYFALLKVN +N
Sbjct: 91  GFGFLRSPEVNYLAGPDDIYISPSQIRRFGLRTGDTVEGQIRAPKAGERYFALLKVNRVN 150

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMEL--NNPENKDISSRVIDLIAPIGKGQRSLIVA 181
           F+ P +  +++HFDNLTPLYPD++  +EL  N+ ++KD S+RVI+L+AP+GKGQR+LIVA
Sbjct: 151 FEDPSKAYHRVHFDNLTPLYPDEKLGLELENNSKDSKDFSTRVIELVAPMGKGQRALIVA 210

Query: 182 PPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAAR 241
           PPRTGKT+LLQNIAH+I  N+PE +LIVLLIDERPEEVTDMQRSV+GEV+SSTFDE A+R
Sbjct: 211 PPRTGKTVLLQNIAHAITTNNPEVFLIVLLIDERPEEVTDMQRSVRGEVVSSTFDEPASR 270

Query: 242 HVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPK 301
           HVQ+AEMVI KAK LVE+  DVVIL+D+ITRL RAYN ++PSSGK+LTGGVDANALQRPK
Sbjct: 271 HVQLAEMVIEKAKRLVEHKKDVVILVDAITRLARAYNTVVPSSGKVLTGGVDANALQRPK 330

Query: 302 RFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAM 361
           RFFGAARNI+ GGSLTIIGTAL++TGSRMDEVIFEEFKGTGNSEIVL+RKIADKRI+PA+
Sbjct: 331 RFFGAARNIENGGSLTIIGTALIETGSRMDEVIFEEFKGTGNSEIVLDRKIADKRIYPAI 390

Query: 362 DIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSM 419
           DI +SGTRKEDLLV++  L K+++LRRI+  M SS+AIEFL+ KL+ TK N +FF  M
Sbjct: 391 DITRSGTRKEDLLVDKIILNKMWVLRRIIDPMGSSEAIEFLLKKLENTKTNGEFFEMM 448


>gi|149185262|ref|ZP_01863579.1| transcription termination factor Rho [Erythrobacter sp. SD-21]
 gi|148831373|gb|EDL49807.1| transcription termination factor Rho [Erythrobacter sp. SD-21]
          Length = 421

 Score =  610 bits (1574), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 294/421 (69%), Positives = 361/421 (85%), Gaps = 3/421 (0%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDV---EIIGEGVIEV 60
           M L++LK K+P  L+A AE L +E A+ MR+Q+LMF IL+ L+  +    +I+G G IEV
Sbjct: 1   MHLKDLKEKTPADLVAMAEELGVEGASTMRRQDLMFCILRELAEDEEYEEKIMGIGTIEV 60

Query: 61  LQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVN 120
           LQDGFGFLRSP+ANYLAGPDDIYVSP+Q++ + L+TGDTVEG IRAP+EGERYFAL K+ 
Sbjct: 61  LQDGFGFLRSPEANYLAGPDDIYVSPNQVRKWGLRTGDTVEGEIRAPKEGERYFALTKLY 120

Query: 121 AINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIV 180
            +NFD P+ VR++ +FDNLTPLYPD++ +++  +P  KD S+RVID+I+P GKGQR+LIV
Sbjct: 121 KVNFDDPDAVRHRTNFDNLTPLYPDEKLSLDTLDPTVKDKSARVIDIISPQGKGQRALIV 180

Query: 181 APPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAA 240
           APPRTGKT+LLQNIA +I  NHPE +L+VLL+DERPEEVTDMQRSV+GEVISSTFDE A 
Sbjct: 181 APPRTGKTVLLQNIAKAITDNHPEVFLLVLLVDERPEEVTDMQRSVKGEVISSTFDEPAN 240

Query: 241 RHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRP 300
           RHVQVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRP
Sbjct: 241 RHVQVAEMVIEKAKRLVEHKHDVVILLDSITRLGRAYNTVVPSSGKVLTGGVDANALQRP 300

Query: 301 KRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPA 360
           KRFFGAARNI+EGGSL+II TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RK+ADKRIFPA
Sbjct: 301 KRFFGAARNIEEGGSLSIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKVADKRIFPA 360

Query: 361 MDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           +D+ KSGTRKE+LLV +  L K+++LRRI+  M + DA+EFL+DK+K +K N+DFF +MN
Sbjct: 361 LDVGKSGTRKEELLVGKDQLSKMWVLRRILMQMGTIDAMEFLLDKMKDSKTNEDFFATMN 420

Query: 421 K 421
           +
Sbjct: 421 Q 421


>gi|254456648|ref|ZP_05070077.1| transcription termination factor Rho [Candidatus Pelagibacter sp.
           HTCC7211]
 gi|207083650|gb|EDZ61076.1| transcription termination factor Rho [Candidatus Pelagibacter sp.
           HTCC7211]
          Length = 422

 Score =  610 bits (1574), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 296/421 (70%), Positives = 361/421 (85%), Gaps = 4/421 (0%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M +QELK KS  +L+A AE L IENA+ +RKQE++F+ILK ++ ++ EI G GV+++LQD
Sbjct: 1   MNIQELKLKSSEQLIAQAEELGIENASTLRKQEILFAILKKVAEKE-EITGAGVLQLLQD 59

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLR+ ++NYL GPDDIYVSPSQI+ F L+TGDTVEG +RAP+EGERYFALL+V+ IN
Sbjct: 60  GFGFLRAMESNYLPGPDDIYVSPSQIRKFGLRTGDTVEGPVRAPKEGERYFALLQVSKIN 119

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPE---NKDISSRVIDLIAPIGKGQRSLIV 180
           F+ PE+ R+KI FDNLTPLYPDK+  ME+   +     D++ R+IDL++PIGKGQRS+I+
Sbjct: 120 FEEPEKARHKIAFDNLTPLYPDKQLVMEVETTKVEKKPDLTPRLIDLVSPIGKGQRSIII 179

Query: 181 APPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAA 240
           +PP+ GKT++LQ+IA+SI KN+PECYLIVLLIDERPEEVTDMQR+V GEVISSTFDE A 
Sbjct: 180 SPPKAGKTMILQSIANSIAKNYPECYLIVLLIDERPEEVTDMQRTVNGEVISSTFDEPAQ 239

Query: 241 RHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRP 300
           RHV VAEMVI KAK L E+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRP
Sbjct: 240 RHVAVAEMVIEKAKRLTEHKKDVVILLDSITRLGRAYNAVIPSSGKVLTGGVDANALQRP 299

Query: 301 KRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPA 360
           KRFFGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSE VL+RKIADKRI+PA
Sbjct: 300 KRFFGAARNIEEGGSLTIISTALIDTGSRMDEVIFEEFKGTGNSETVLDRKIADKRIYPA 359

Query: 361 MDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           +DI KSGTR+E+LL E+ DLQK+ +LRRI++ M + DAIEF+  KLK TK+N +FF SMN
Sbjct: 360 IDITKSGTRREELLFEKNDLQKMNVLRRIIAPMGTMDAIEFISSKLKDTKNNAEFFNSMN 419

Query: 421 K 421
           K
Sbjct: 420 K 420


>gi|157803727|ref|YP_001492276.1| transcription termination factor Rho [Rickettsia canadensis str.
           McKiel]
 gi|157784990|gb|ABV73491.1| transcription termination factor Rho [Rickettsia canadensis str.
           McKiel]
          Length = 458

 Score =  610 bits (1574), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 296/418 (70%), Positives = 358/418 (85%), Gaps = 2/418 (0%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           + L++LK K P +L   AE L+IEN N + KQEL+F+ILK    +   I+GEGV+EVL D
Sbjct: 31  INLKQLKRKLPEELQVQAEELKIENINSLLKQELVFAILKKSVEQGGLIVGEGVLEVLPD 90

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSP+ NYLAGPDDIY+SPSQI+ F L+TGDTVEG IRAP+ GERYFALLKVN +N
Sbjct: 91  GFGFLRSPEVNYLAGPDDIYISPSQIRRFGLRTGDTVEGQIRAPKAGERYFALLKVNRVN 150

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMEL--NNPENKDISSRVIDLIAPIGKGQRSLIVA 181
           F+ P +  +++HFDNLTPLYPDK+  +EL  N+ + KD S+RVI+L+AP+GKGQR+LIVA
Sbjct: 151 FEDPSKAYHRVHFDNLTPLYPDKKLGLELENNSKDTKDFSTRVIELVAPMGKGQRALIVA 210

Query: 182 PPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAAR 241
           PPRTGKT+LLQNIAH+I  N+PE +LIVLLIDERPEEVTDMQRSV+GEV+SSTFDE A+R
Sbjct: 211 PPRTGKTVLLQNIAHAITTNNPEVFLIVLLIDERPEEVTDMQRSVRGEVVSSTFDEPASR 270

Query: 242 HVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPK 301
           HVQ+AEMVI KAK LVE+  DVVIL+D+ITRL RAYN ++PSSGK+LTGGVDANALQRPK
Sbjct: 271 HVQLAEMVIEKAKRLVEHKKDVVILVDAITRLARAYNTVVPSSGKVLTGGVDANALQRPK 330

Query: 302 RFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAM 361
           RFFGAARNI+ GGSLTIIGTAL++TGSRMDEVIFEEFKGTGNSEIVL+RKIADKRI+PA+
Sbjct: 331 RFFGAARNIENGGSLTIIGTALIETGSRMDEVIFEEFKGTGNSEIVLDRKIADKRIYPAI 390

Query: 362 DIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSM 419
           DI +SGTRKEDLLV++  L K+++LRRI+  M SS+AIEFL+ KL+ TK N +FF  M
Sbjct: 391 DITRSGTRKEDLLVDKIILNKMWVLRRIIDPMGSSEAIEFLLKKLENTKTNGEFFEMM 448


>gi|85709806|ref|ZP_01040871.1| transcription termination factor Rho [Erythrobacter sp. NAP1]
 gi|85688516|gb|EAQ28520.1| transcription termination factor Rho [Erythrobacter sp. NAP1]
          Length = 421

 Score =  610 bits (1573), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 294/421 (69%), Positives = 360/421 (85%), Gaps = 3/421 (0%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDV---EIIGEGVIEV 60
           M L++LK ++P  L+A AE L +E A+ MR+Q+L+FSIL+ L+  +    +I+G G IEV
Sbjct: 1   MHLKDLKERTPADLVAMAEELGVEGASTMRRQDLLFSILRELAEDEEYEEKIMGIGTIEV 60

Query: 61  LQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVN 120
           LQDGFGFLRSP+ANYLAGPDDIYVSP+QI+ + L+TGDTVEG IRAPREGERYFAL  + 
Sbjct: 61  LQDGFGFLRSPEANYLAGPDDIYVSPNQIRKWGLRTGDTVEGEIRAPREGERYFALTSLA 120

Query: 121 AINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIV 180
            +NF+ P  VR + +FDNLTPLYPD++ N++  +P  KD S+RVID+I+P GKGQR+LIV
Sbjct: 121 KVNFEDPAAVRMRTNFDNLTPLYPDQKLNLDTVDPTVKDKSARVIDIISPQGKGQRALIV 180

Query: 181 APPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAA 240
           APPRTGKT+LLQNIA +I  NHPE +L+VLL+DERPEEVTDMQRSV+GEVISSTFDE A 
Sbjct: 181 APPRTGKTVLLQNIAKAITDNHPEVFLLVLLVDERPEEVTDMQRSVKGEVISSTFDEPAN 240

Query: 241 RHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRP 300
           RHVQVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRP
Sbjct: 241 RHVQVAEMVIEKAKRLVEHKHDVVILLDSITRLGRAYNTVVPSSGKVLTGGVDANALQRP 300

Query: 301 KRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPA 360
           KRFFGAARNI+EGGSL+II TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RK++DKRIFPA
Sbjct: 301 KRFFGAARNIEEGGSLSIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKVSDKRIFPA 360

Query: 361 MDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           +D+ KSGTRKE+LLVE+  L K+++LRRI+  M + DA+EFL+DK+K +K N+DFF +MN
Sbjct: 361 LDVGKSGTRKEELLVEKDKLSKMWVLRRILMQMGTVDAMEFLLDKMKDSKTNEDFFDTMN 420

Query: 421 K 421
           +
Sbjct: 421 Q 421


>gi|157964583|ref|YP_001499407.1| transcription termination factor Rho [Rickettsia massiliae MTU5]
 gi|157844359|gb|ABV84860.1| Transcription termination factor [Rickettsia massiliae MTU5]
          Length = 468

 Score =  609 bits (1570), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 296/418 (70%), Positives = 360/418 (86%), Gaps = 2/418 (0%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           + L++LK K P +L A AE L+IEN N + KQEL+F+ILK    +   I+GEGV+EVL D
Sbjct: 41  INLKQLKRKLPEELQAQAEELKIENINSLLKQELVFAILKKSVEQGGLIVGEGVLEVLPD 100

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSP+ NYLAGPDDIY+SPSQI+ F L+TGDTVEG IRAP+ GERYFALLKVN +N
Sbjct: 101 GFGFLRSPEVNYLAGPDDIYISPSQIRRFGLRTGDTVEGQIRAPKAGERYFALLKVNRVN 160

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMEL--NNPENKDISSRVIDLIAPIGKGQRSLIVA 181
           F+ P +  +++HFDNLTPLYPD++  +EL  N+ ++KD S+RVI+L+AP+GKGQR+LIVA
Sbjct: 161 FEDPFKAYHRVHFDNLTPLYPDEKLGLELENNSKDSKDFSTRVIELVAPMGKGQRALIVA 220

Query: 182 PPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAAR 241
           PPRTGKT+LLQNIAH+I  N+PE +LIVLLIDERPEEVTDMQRSV+GEV+SSTFDE A+R
Sbjct: 221 PPRTGKTVLLQNIAHAITTNNPEVFLIVLLIDERPEEVTDMQRSVRGEVVSSTFDEPASR 280

Query: 242 HVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPK 301
           HVQ+AEMVI KAK LVE+  DVVIL+D+ITRL RAYN ++PSSGK+LTGGVDANALQRPK
Sbjct: 281 HVQLAEMVIKKAKRLVEHKKDVVILVDAITRLARAYNTVVPSSGKVLTGGVDANALQRPK 340

Query: 302 RFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAM 361
           RFFGAARNI+ GGSLTIIGTAL++TGSRMDEVIFEEFKGTGNSEIVL+RKIADKRI+PA+
Sbjct: 341 RFFGAARNIENGGSLTIIGTALIETGSRMDEVIFEEFKGTGNSEIVLDRKIADKRIYPAI 400

Query: 362 DIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSM 419
           DI +SGTRKEDLLV++  L K+++LRRI+  M SS+AIEFL+ KL+ TK N +FF  M
Sbjct: 401 DITRSGTRKEDLLVDKIILNKMWVLRRIIDPMGSSEAIEFLLKKLENTKTNGEFFEMM 458


>gi|239947711|ref|ZP_04699464.1| transcription termination factor Rho [Rickettsia endosymbiont of
           Ixodes scapularis]
 gi|239921987|gb|EER22011.1| transcription termination factor Rho [Rickettsia endosymbiont of
           Ixodes scapularis]
          Length = 454

 Score =  608 bits (1567), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 294/418 (70%), Positives = 360/418 (86%), Gaps = 2/418 (0%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           + L++LK K P +L A AE L+IEN N + KQEL+F+ILK    +   I+GEGV+EVL D
Sbjct: 27  INLKQLKRKLPEELQAQAEELKIENINSLLKQELVFAILKKSVEQGGLIVGEGVLEVLPD 86

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSP+ NYLAGPDDIY+SPSQI+ F L+TGDTVEG IRAP+ GERYFALLKVN +N
Sbjct: 87  GFGFLRSPEVNYLAGPDDIYISPSQIRRFGLRTGDTVEGQIRAPKAGERYFALLKVNRVN 146

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMEL--NNPENKDISSRVIDLIAPIGKGQRSLIVA 181
           F+ P +  +++HFDNLTPLYPD++  +EL  N+ ++KD S+RVI+L+AP+GKGQR+LIVA
Sbjct: 147 FEDPSKAYHRVHFDNLTPLYPDEKLGLELENNSKDSKDFSTRVIELVAPMGKGQRALIVA 206

Query: 182 PPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAAR 241
           PPRTGKT+LLQNIAH+I  N+PE +LIVLLIDERPEEVTDMQRSV+GEV+SSTFDE A+R
Sbjct: 207 PPRTGKTVLLQNIAHAITTNNPEVFLIVLLIDERPEEVTDMQRSVRGEVVSSTFDEPASR 266

Query: 242 HVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPK 301
           H+Q+AEMVI KAK LVE+  DVVIL+D+ITRL RAYN ++PSSGK+LTGGVDANALQRPK
Sbjct: 267 HMQLAEMVIEKAKRLVEHKKDVVILVDAITRLARAYNTVVPSSGKVLTGGVDANALQRPK 326

Query: 302 RFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAM 361
           RFFGAARNI+ GGSLTIIGTAL++TGSRMDEVIFEEFKGTGNSEIVL+RKIADKRI+PA+
Sbjct: 327 RFFGAARNIENGGSLTIIGTALIETGSRMDEVIFEEFKGTGNSEIVLDRKIADKRIYPAI 386

Query: 362 DIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSM 419
           D+ +SGTRKEDLLV++  L K+++LRRI+  M SS+AIEFL+ KL+ TK N +FF  M
Sbjct: 387 DMTRSGTRKEDLLVDKIILNKMWVLRRIIDPMGSSEAIEFLLKKLENTKTNGEFFEMM 444


>gi|51473707|ref|YP_067464.1| transcription termination factor Rho [Rickettsia typhi str.
           Wilmington]
 gi|51460019|gb|AAU03982.1| transcription termination factor Rho [Rickettsia typhi str.
           Wilmington]
          Length = 450

 Score =  605 bits (1559), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 294/418 (70%), Positives = 358/418 (85%), Gaps = 2/418 (0%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           + L++LK K P +L   AE L+IEN + + KQEL+F+ILK    +   I+G+GV+EVL D
Sbjct: 23  INLKQLKRKLPEELQVQAEELKIENISSLLKQELVFAILKKSVEQGGLIVGDGVLEVLPD 82

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSP+ NYLAGPDDIY+SPSQI+ F L+TGDTVEG IRAP+ GERYFALLKVN +N
Sbjct: 83  GFGFLRSPEVNYLAGPDDIYISPSQIRRFGLRTGDTVEGQIRAPKAGERYFALLKVNRVN 142

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMEL--NNPENKDISSRVIDLIAPIGKGQRSLIVA 181
           FD P    +++HFDNLTPLYPD++  +EL  N+ ++KD S+RVI+L+AP+GKGQR+LIVA
Sbjct: 143 FDDPVNAYHRVHFDNLTPLYPDEKLGLELENNSKDSKDFSTRVIELVAPMGKGQRALIVA 202

Query: 182 PPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAAR 241
           PPRTGKT+LLQNIAH+I  N+PE +LIVLLIDERPEEVTDMQRSV+GEV+SSTFDE A+R
Sbjct: 203 PPRTGKTVLLQNIAHAITTNNPEVFLIVLLIDERPEEVTDMQRSVRGEVVSSTFDEPASR 262

Query: 242 HVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPK 301
           HVQ+AEMVI KAK LVE+  DVVIL+D+ITRL RAYN ++PSSGK+LTGGVDANALQRPK
Sbjct: 263 HVQLAEMVIEKAKRLVEHKKDVVILVDAITRLARAYNTVVPSSGKVLTGGVDANALQRPK 322

Query: 302 RFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAM 361
           RFFGAARNI+ GGSLTIIGTAL++TGSRMDEVIFEEFKGTGNSEIVL+RKIADKRI+PA+
Sbjct: 323 RFFGAARNIENGGSLTIIGTALIETGSRMDEVIFEEFKGTGNSEIVLDRKIADKRIYPAI 382

Query: 362 DIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSM 419
           DI +SGTRKEDLLV++  L K+++LRRI+  M SS+AIEFL+ KL+ TK N +FF  M
Sbjct: 383 DITRSGTRKEDLLVDKIILNKMWVLRRIIDPMGSSEAIEFLLKKLENTKTNYEFFEMM 440


>gi|147732424|sp|Q68WL0|RHO_RICTY RecName: Full=Transcription termination factor Rho; AltName:
           Full=ATP-dependent helicase Rho
          Length = 457

 Score =  605 bits (1559), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 294/418 (70%), Positives = 358/418 (85%), Gaps = 2/418 (0%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           + L++LK K P +L   AE L+IEN + + KQEL+F+ILK    +   I+G+GV+EVL D
Sbjct: 30  INLKQLKRKLPEELQVQAEELKIENISSLLKQELVFAILKKSVEQGGLIVGDGVLEVLPD 89

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSP+ NYLAGPDDIY+SPSQI+ F L+TGDTVEG IRAP+ GERYFALLKVN +N
Sbjct: 90  GFGFLRSPEVNYLAGPDDIYISPSQIRRFGLRTGDTVEGQIRAPKAGERYFALLKVNRVN 149

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMEL--NNPENKDISSRVIDLIAPIGKGQRSLIVA 181
           FD P    +++HFDNLTPLYPD++  +EL  N+ ++KD S+RVI+L+AP+GKGQR+LIVA
Sbjct: 150 FDDPVNAYHRVHFDNLTPLYPDEKLGLELENNSKDSKDFSTRVIELVAPMGKGQRALIVA 209

Query: 182 PPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAAR 241
           PPRTGKT+LLQNIAH+I  N+PE +LIVLLIDERPEEVTDMQRSV+GEV+SSTFDE A+R
Sbjct: 210 PPRTGKTVLLQNIAHAITTNNPEVFLIVLLIDERPEEVTDMQRSVRGEVVSSTFDEPASR 269

Query: 242 HVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPK 301
           HVQ+AEMVI KAK LVE+  DVVIL+D+ITRL RAYN ++PSSGK+LTGGVDANALQRPK
Sbjct: 270 HVQLAEMVIEKAKRLVEHKKDVVILVDAITRLARAYNTVVPSSGKVLTGGVDANALQRPK 329

Query: 302 RFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAM 361
           RFFGAARNI+ GGSLTIIGTAL++TGSRMDEVIFEEFKGTGNSEIVL+RKIADKRI+PA+
Sbjct: 330 RFFGAARNIENGGSLTIIGTALIETGSRMDEVIFEEFKGTGNSEIVLDRKIADKRIYPAI 389

Query: 362 DIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSM 419
           DI +SGTRKEDLLV++  L K+++LRRI+  M SS+AIEFL+ KL+ TK N +FF  M
Sbjct: 390 DITRSGTRKEDLLVDKIILNKMWVLRRIIDPMGSSEAIEFLLKKLENTKTNYEFFEMM 447


>gi|15604383|ref|NP_220899.1| transcription termination factor Rho [Rickettsia prowazekii str.
           Madrid E]
 gi|6647729|sp|Q9ZD24|RHO_RICPR RecName: Full=Transcription termination factor Rho; AltName:
           Full=ATP-dependent helicase Rho
 gi|3861075|emb|CAA14975.1| TRANSCRIPTION TERMINATION FACTOR RHO (rho) [Rickettsia prowazekii]
 gi|292572138|gb|ADE30053.1| Transcription termination factor [Rickettsia prowazekii Rp22]
          Length = 457

 Score =  604 bits (1558), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 294/418 (70%), Positives = 358/418 (85%), Gaps = 2/418 (0%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           + L++LK K P +L   AE L+IEN + + KQEL+F+ILK    +   I+GEGV+EVL D
Sbjct: 30  INLKQLKRKLPEELQVQAEELKIENISSLLKQELVFAILKKSVEQGGLIVGEGVLEVLPD 89

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSP+ NYLAGPDDIY+SPSQI+ F L+TGDTVEG IRAP+ GERYFALLKVN +N
Sbjct: 90  GFGFLRSPEVNYLAGPDDIYISPSQIRRFGLRTGDTVEGQIRAPKAGERYFALLKVNRVN 149

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMEL--NNPENKDISSRVIDLIAPIGKGQRSLIVA 181
           F+ P +  +++HFDNLTPLYPD++  +EL  N+ ++KD S+RVI+L+AP+GKGQR+LIVA
Sbjct: 150 FEDPAKAYHRVHFDNLTPLYPDEKLGLELENNSKDSKDFSTRVIELVAPMGKGQRALIVA 209

Query: 182 PPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAAR 241
           PPRTGKT+LLQNIAH+I  N+PE +LIVLLIDERPEEVTDMQRSV+GEV+SSTFDE A+R
Sbjct: 210 PPRTGKTVLLQNIAHAITTNNPEVFLIVLLIDERPEEVTDMQRSVRGEVVSSTFDEPASR 269

Query: 242 HVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPK 301
           HVQ+AEMVI KAK LVE+  DVVIL+D+ITRL RAYN ++PSSGK+LTGGVDANALQRPK
Sbjct: 270 HVQLAEMVIEKAKRLVEHKKDVVILVDAITRLARAYNTVVPSSGKVLTGGVDANALQRPK 329

Query: 302 RFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAM 361
           RFFGAARNI+ GGSLTIIGTAL++TGSRMDEVIFEEFKGTGNSEIVL+RKIADKRI+PA+
Sbjct: 330 RFFGAARNIENGGSLTIIGTALIETGSRMDEVIFEEFKGTGNSEIVLDRKIADKRIYPAI 389

Query: 362 DIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSM 419
           DI +SGTRKEDLLV++  L K+++LRRI+  M SS+AIEFL+ KL+ TK N  FF  M
Sbjct: 390 DITRSGTRKEDLLVDKIILNKMWVLRRIIDPMGSSEAIEFLLKKLENTKTNCAFFEMM 447


>gi|330813365|ref|YP_004357604.1| transcription termination factor Rho [Candidatus Pelagibacter sp.
           IMCC9063]
 gi|327486460|gb|AEA80865.1| transcription termination factor Rho [Candidatus Pelagibacter sp.
           IMCC9063]
          Length = 422

 Score =  603 bits (1556), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 296/421 (70%), Positives = 361/421 (85%), Gaps = 3/421 (0%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M LQELK+K+P  L+  AE L+IEN + MRKQE++F+ILK L+ ++ +I   GV+E LQD
Sbjct: 1   MNLQELKDKTPADLILEAEKLDIENPSTMRKQEILFAILKKLAEKNEQITASGVLETLQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLR+ ++NYL GPDDIYVSPSQIK F L+ GDTVEG IRAP+E ERYFALL+VN IN
Sbjct: 61  GFGFLRAMESNYLPGPDDIYVSPSQIKRFGLRKGDTVEGEIRAPKEQERYFALLQVNKIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPE---NKDISSRVIDLIAPIGKGQRSLIV 180
           F+ PE+ RNKI+FDNLTPLYP  +  +E+   +     D+++R+IDLIAPIGKGQRSLIV
Sbjct: 121 FEDPEKTRNKINFDNLTPLYPQDKLKLEIETTKIEKKADVTTRLIDLIAPIGKGQRSLIV 180

Query: 181 APPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAA 240
           +PPRTGKT++LQNIAHSI  NHPE YLIVLLIDERPEEVTDMQRSV+GEV+SSTFDE A 
Sbjct: 181 SPPRTGKTVVLQNIAHSITTNHPEVYLIVLLIDERPEEVTDMQRSVKGEVVSSTFDEPAM 240

Query: 241 RHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRP 300
           RHVQVAEMVI KAK L E+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRP
Sbjct: 241 RHVQVAEMVIEKAKRLAEHKKDVVILLDSITRLGRAYNAVVPSSGKVLTGGVDANALQRP 300

Query: 301 KRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPA 360
           KRFFGAARNI+EGGSLTII TAL++TGSRMDEVIFEEFKGTGNSE++++RK+ADKRI+PA
Sbjct: 301 KRFFGAARNIEEGGSLTIISTALIETGSRMDEVIFEEFKGTGNSEVIMDRKVADKRIYPA 360

Query: 361 MDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           +DI KSGTRKE+LL+ +++L K+ +LRRI++ M + DA+EF+I KL++TK+N +FF SMN
Sbjct: 361 IDITKSGTRKEELLLSKEELSKMNVLRRIINPMGTMDAVEFMIGKLRETKNNAEFFDSMN 420

Query: 421 K 421
           K
Sbjct: 421 K 421


>gi|71083054|ref|YP_265773.1| transcription termination factor Rho [Candidatus Pelagibacter
           ubique HTCC1062]
 gi|91762521|ref|ZP_01264486.1| transcription termination factor Rho [Candidatus Pelagibacter
           ubique HTCC1002]
 gi|71062167|gb|AAZ21170.1| transcription termination factor rho [Candidatus Pelagibacter
           ubique HTCC1062]
 gi|91718323|gb|EAS84973.1| transcription termination factor Rho [Candidatus Pelagibacter
           ubique HTCC1002]
          Length = 422

 Score =  602 bits (1552), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 291/421 (69%), Positives = 361/421 (85%), Gaps = 4/421 (0%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M +QELK KS  +L+A AE L IENA+ +RKQE++F+ILK ++ ++ EI G GV+++LQD
Sbjct: 1   MNIQELKLKSSEQLIAQAEKLGIENASTLRKQEILFAILKKVAEKE-EITGAGVLQLLQD 59

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLR+ ++NYLAGPDDIYVSPSQI+ F L+TGDTVEG +RAP+EGERYFALL+V  IN
Sbjct: 60  GFGFLRAMESNYLAGPDDIYVSPSQIRKFGLRTGDTVEGPVRAPKEGERYFALLQVEKIN 119

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPE---NKDISSRVIDLIAPIGKGQRSLIV 180
           F+ PE+ R+KI FDNLTPLYP+K+  ME+   +     D++ R+IDL++PIGKGQRS+I+
Sbjct: 120 FEEPEKARHKIAFDNLTPLYPNKQMVMEVETTKIEKKPDLTPRLIDLVSPIGKGQRSIII 179

Query: 181 APPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAA 240
           +PP+ GKT++LQ+IA+SI KN+PE YL+VLLIDERPEEVTDM+R+V+GEVISSTFDE A+
Sbjct: 180 SPPKAGKTMILQSIANSIAKNYPESYLMVLLIDERPEEVTDMKRTVKGEVISSTFDEPAS 239

Query: 241 RHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRP 300
           RHV VAEMVI KAK L E+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRP
Sbjct: 240 RHVAVAEMVIEKAKRLTEHKKDVVILLDSITRLGRAYNAVIPSSGKVLTGGVDANALQRP 299

Query: 301 KRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPA 360
           KRFFGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSE VL+RKIA++RI+PA
Sbjct: 300 KRFFGAARNIEEGGSLTIISTALIDTGSRMDEVIFEEFKGTGNSETVLDRKIAERRIYPA 359

Query: 361 MDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           +DI KSGTR+E+LL ++ DL K+ +LRRI+S M + DAIEF+  KLK+TK N DFF SMN
Sbjct: 360 IDITKSGTRREELLFDKDDLSKMNVLRRIISPMGTMDAIEFINSKLKETKSNADFFSSMN 419

Query: 421 K 421
           K
Sbjct: 420 K 420


>gi|85706892|ref|ZP_01037982.1| transcription termination factor Rho [Roseovarius sp. 217]
 gi|85668503|gb|EAQ23374.1| transcription termination factor Rho [Roseovarius sp. 217]
          Length = 370

 Score =  602 bits (1551), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 285/369 (77%), Positives = 330/369 (89%)

Query: 52  IIGEGVIEVLQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGE 111
           + G+GV+EVLQDGFGFLRSP+ANYL GPDDIYVSP  I+ +SL+TGDT+EG ++ P E E
Sbjct: 1   VYGDGVLEVLQDGFGFLRSPEANYLPGPDDIYVSPDMIRQYSLRTGDTIEGQMKQPDETE 60

Query: 112 RYFALLKVNAINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPI 171
           RYFAL  V  INF+ PER R+KI FDNLTPLYPD+RF ME+ +P  KD S+R+IDL+API
Sbjct: 61  RYFALTSVTQINFEDPERARHKIAFDNLTPLYPDERFKMEIEDPTIKDRSARIIDLVAPI 120

Query: 172 GKGQRSLIVAPPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVI 231
           GKGQRSLIVAPPRTGKT+LLQNIA+SI+KNHPECYLIVLLIDERPEEVTDMQRSV+GEV+
Sbjct: 121 GKGQRSLIVAPPRTGKTVLLQNIANSIEKNHPECYLIVLLIDERPEEVTDMQRSVKGEVV 180

Query: 232 SSTFDESAARHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGG 291
           SSTFDE A RHV VAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGG
Sbjct: 181 SSTFDEPATRHVAVAEMVIEKAKRLVEHKRDVVILLDSITRLGRAYNTVVPSSGKVLTGG 240

Query: 292 VDANALQRPKRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERK 351
           VDANALQRPKRFFGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGNSEIVL+RK
Sbjct: 241 VDANALQRPKRFFGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRK 300

Query: 352 IADKRIFPAMDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKD 411
           +ADKR+FPA+DI+KSGTRKEDLL+++ DLQK F+LRRI++ M ++DA+EFL+ KLKQTK 
Sbjct: 301 VADKRVFPAIDILKSGTRKEDLLIDKGDLQKTFVLRRILNPMGTTDAVEFLLSKLKQTKT 360

Query: 412 NKDFFYSMN 420
           N +FF SMN
Sbjct: 361 NAEFFDSMN 369


>gi|90414229|ref|ZP_01222209.1| transcription termination factor Rho [Photobacterium profundum
           3TCK]
 gi|90324676|gb|EAS41217.1| transcription termination factor Rho [Photobacterium profundum
           3TCK]
          Length = 421

 Score =  590 bits (1522), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 285/419 (68%), Positives = 348/419 (83%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELKN+   KL+A  ESL +EN   +RKQ+++FSILK  +    +I G+GV+E+LQD
Sbjct: 1   MNLTELKNQPIPKLVALGESLGLENLARLRKQDIIFSILKQHAKGGEDIFGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGDTV G IR P++GERYFALLKVNA+N
Sbjct: 61  GFGFLRSSDSSYLAGPDDIYVSPSQIRRFNLRTGDTVAGKIRPPKDGERYFALLKVNAVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           +D P+  RNKI F+NLTPL+ + R  ME  N   +DI++RV+DL +PIGKGQR LIVAPP
Sbjct: 121 YDKPDNARNKILFENLTPLHANDRMRMERGNGSTEDITARVLDLASPIGKGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKTILLQNIA SI  NHPEC L+VLLIDERPEEVT+MQR V+GEVI+STFDE A+RHV
Sbjct: 181 KAGKTILLQNIAQSIAHNHPECELMVLLIDERPEEVTEMQRLVKGEVIASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANAL RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVVPSSGKVLTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TALVDTGS+MDEVI+EEFKGTGN E+ L RKIA+KR+FPA+D 
Sbjct: 301 FGAARNVEEGGSLTIIATALVDTGSKMDEVIYEEFKGTGNMELHLSRKIAEKRVFPAIDF 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQ 422
            +SGTR+E+LL +  +LQK+++LR+IV  M  +D++EFLIDKL  TK N +FF +M +Q
Sbjct: 361 NRSGTRREELLAKPDELQKMWILRKIVHPMGETDSMEFLIDKLSMTKTNNEFFDAMRRQ 419


>gi|261751205|ref|ZP_05994914.1| transcription termination factor Rho [Brucella suis bv. 5 str. 513]
 gi|261740958|gb|EEY28884.1| transcription termination factor Rho [Brucella suis bv. 5 str. 513]
          Length = 352

 Score =  590 bits (1522), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 280/339 (82%), Positives = 312/339 (92%)

Query: 1   MSEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEV 60
           M EMKLQELKNK+P +LLAFAE+LE+ENA+ MRKQELMF+ILK L+ +DVEIIGEGV+EV
Sbjct: 14  MQEMKLQELKNKTPVELLAFAETLEVENASAMRKQELMFAILKKLAAQDVEIIGEGVVEV 73

Query: 61  LQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVN 120
           LQDGFGFLRS DANYL GPDDIY+SPSQ++ FSLKTGDTVEG IR P+EGERYFALLKVN
Sbjct: 74  LQDGFGFLRSADANYLPGPDDIYISPSQLRRFSLKTGDTVEGPIRGPKEGERYFALLKVN 133

Query: 121 AINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIV 180
            INF+ PE++R+K+HFDNLTPLYP++RF MEL  P +KD+S RVIDL+AP+GKGQR LIV
Sbjct: 134 TINFEDPEKIRHKVHFDNLTPLYPNERFKMELEVPTSKDLSPRVIDLVAPLGKGQRGLIV 193

Query: 181 APPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAA 240
           APPRTGKT+LLQNIAHSI  NHPECYLIVLLIDERPEEVTDMQRSV+GEVISSTFDE AA
Sbjct: 194 APPRTGKTVLLQNIAHSITANHPECYLIVLLIDERPEEVTDMQRSVKGEVISSTFDEPAA 253

Query: 241 RHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRP 300
           RHVQVAEMVI KAK LVE+G DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRP
Sbjct: 254 RHVQVAEMVIEKAKRLVEHGRDVVILLDSITRLGRAYNTVVPSSGKVLTGGVDANALQRP 313

Query: 301 KRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFK 339
           KRFFGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFK
Sbjct: 314 KRFFGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFK 352


>gi|330447220|ref|ZP_08310870.1| transcription termination factor Rho [Photobacterium leiognathi
           subsp. mandapamensis svers.1.1.]
 gi|328491411|dbj|GAA05367.1| transcription termination factor Rho [Photobacterium leiognathi
           subsp. mandapamensis svers.1.1.]
          Length = 421

 Score =  590 bits (1521), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 282/419 (67%), Positives = 350/419 (83%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK++  +KL+A  ESL +EN   +RKQ+++FSILK  +    +I G+GV+E+LQD
Sbjct: 1   MNLTELKSQPISKLVALGESLGLENLARLRKQDIIFSILKQHAKSGEDIFGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P++GERYFALLKVN +N
Sbjct: 61  GFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTIAGKIRPPKDGERYFALLKVNEVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           +D P+  RNKI F+NLTPL+ + R  ME  N   +DI++RV+DL +PIGKGQR LIVAPP
Sbjct: 121 YDKPDNARNKILFENLTPLHANSRMRMERGNGSTEDITARVLDLASPIGKGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA SI  NHPEC L+VLLIDERPEEVT+MQR V+GEVI+STFDE A+RHV
Sbjct: 181 KAGKTMLLQNIAQSIAHNHPECELMVLLIDERPEEVTEMQRLVKGEVIASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANAL RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVIPSSGKVLTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TALVDTGS+MDEVI+EEFKGTGN E+ L RKIA+KR+FPA+DI
Sbjct: 301 FGAARNVEEGGSLTIIATALVDTGSKMDEVIYEEFKGTGNMELHLSRKIAEKRVFPAIDI 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQ 422
            +SGTR+E+LL +  +LQK+++LR+IV  M+ +D++EFLIDKL  TK N +FF +M +Q
Sbjct: 361 NRSGTRREELLAKADELQKMWILRKIVHPMSETDSMEFLIDKLSMTKTNDEFFDAMRRQ 419


>gi|254700695|ref|ZP_05162523.1| transcription termination factor Rho [Brucella suis bv. 5 str. 513]
          Length = 339

 Score =  590 bits (1520), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 280/339 (82%), Positives = 312/339 (92%)

Query: 1   MSEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEV 60
           M EMKLQELKNK+P +LLAFAE+LE+ENA+ MRKQELMF+ILK L+ +DVEIIGEGV+EV
Sbjct: 1   MQEMKLQELKNKTPVELLAFAETLEVENASAMRKQELMFAILKKLAAQDVEIIGEGVVEV 60

Query: 61  LQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVN 120
           LQDGFGFLRS DANYL GPDDIY+SPSQ++ FSLKTGDTVEG IR P+EGERYFALLKVN
Sbjct: 61  LQDGFGFLRSADANYLPGPDDIYISPSQLRRFSLKTGDTVEGPIRGPKEGERYFALLKVN 120

Query: 121 AINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIV 180
            INF+ PE++R+K+HFDNLTPLYP++RF MEL  P +KD+S RVIDL+AP+GKGQR LIV
Sbjct: 121 TINFEDPEKIRHKVHFDNLTPLYPNERFKMELEVPTSKDLSPRVIDLVAPLGKGQRGLIV 180

Query: 181 APPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAA 240
           APPRTGKT+LLQNIAHSI  NHPECYLIVLLIDERPEEVTDMQRSV+GEVISSTFDE AA
Sbjct: 181 APPRTGKTVLLQNIAHSITANHPECYLIVLLIDERPEEVTDMQRSVKGEVISSTFDEPAA 240

Query: 241 RHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRP 300
           RHVQVAEMVI KAK LVE+G DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRP
Sbjct: 241 RHVQVAEMVIEKAKRLVEHGRDVVILLDSITRLGRAYNTVVPSSGKVLTGGVDANALQRP 300

Query: 301 KRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFK 339
           KRFFGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFK
Sbjct: 301 KRFFGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFK 339


>gi|114777397|ref|ZP_01452394.1| transcription termination factor Rho [Mariprofundus ferrooxydans
           PV-1]
 gi|114552179|gb|EAU54681.1| transcription termination factor Rho [Mariprofundus ferrooxydans
           PV-1]
          Length = 639

 Score =  589 bits (1518), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 280/418 (66%), Positives = 345/418 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           + L+E+  ++PT+LL  A+S  IENA  MRKQE + +IL+    R   I  EGV+E+L D
Sbjct: 222 LNLKEVSARTPTELLELADSYGIENAAGMRKQEQVSAILRAHGLRSGTIYSEGVLEILPD 281

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSPDANYL+G DD+YVS  QI+ F L+ GDTV G IR+PR GE+YFAL  V+  N
Sbjct: 282 GFGFLRSPDANYLSGSDDVYVSTHQIRRFYLRKGDTVAGEIRSPRRGEKYFALKTVDTTN 341

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
            + PE  R K+ FDNLTPLYP++R  ME+++P +KDI+ R+ID+++PIGKGQR+L+VAPP
Sbjct: 342 GEPPEVARTKVLFDNLTPLYPNERLKMEIDDPTHKDITGRIIDIVSPIGKGQRALLVAPP 401

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           RTGKT+++Q+IAHSI  NHPE  L+VLLIDERPEEVTDM+RSV+GEV+SSTFDE A RHV
Sbjct: 402 RTGKTVMMQSIAHSIAANHPEVVLMVLLIDERPEEVTDMKRSVKGEVVSSTFDEPAQRHV 461

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QV+EMVI KAK LVE+G DVVILLDSITRL RAYN ++PSSGKILTGGVDANAL RPKRF
Sbjct: 462 QVSEMVIEKAKRLVEHGRDVVILLDSITRLARAYNTVVPSSGKILTGGVDANALHRPKRF 521

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+ GGSLTII TALV+TGS+MDEVIFEEFKGTGN EI L+RK+ DKR+FP++DI
Sbjct: 522 FGAARNIEGGGSLTIIATALVETGSKMDEVIFEEFKGTGNMEIKLDRKLTDKRVFPSIDI 581

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
             SGTRKE+LL  R+DLQKV++LR+I+S M + DA+EFLIDKL  TK+N +FF  MN+
Sbjct: 582 APSGTRKEELLTPREDLQKVWILRKILSPMGTIDAMEFLIDKLGPTKNNAEFFDRMNQ 639


>gi|54310593|ref|YP_131613.1| transcription termination factor Rho [Photobacterium profundum SS9]
 gi|46915036|emb|CAG21811.1| putative transcription termination factor [Photobacterium profundum
           SS9]
          Length = 455

 Score =  589 bits (1518), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 284/421 (67%), Positives = 350/421 (83%)

Query: 2   SEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVL 61
           + M L ELK++   KL+A +ESL +EN   +RKQ+++FSILK  +    +I G+GV+E+L
Sbjct: 34  TTMNLTELKSQPIPKLVALSESLGLENLARLRKQDIIFSILKQHAKGGEDIFGDGVLEIL 93

Query: 62  QDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNA 121
           QDGFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGDTV G IR P++GERYFALLKVNA
Sbjct: 94  QDGFGFLRSSDSSYLAGPDDIYVSPSQIRRFNLRTGDTVAGKIRPPKDGERYFALLKVNA 153

Query: 122 INFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVA 181
           +N+D P+  RNKI F+NLTPL+ + R  ME  N   +DI++RV+DL +PIGKGQR LIVA
Sbjct: 154 VNYDKPDNARNKILFENLTPLHANDRMRMERGNGSTEDITARVLDLASPIGKGQRGLIVA 213

Query: 182 PPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAAR 241
           PP+ GKTILLQNIA SI  NHPEC L+VLLIDERPEEVT+MQR V+GEVI+STFDE A+R
Sbjct: 214 PPKAGKTILLQNIAQSIAHNHPECVLMVLLIDERPEEVTEMQRLVKGEVIASTFDEPASR 273

Query: 242 HVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPK 301
           HVQVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANAL RPK
Sbjct: 274 HVQVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVVPSSGKVLTGGVDANALHRPK 333

Query: 302 RFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAM 361
           RFFGAARN++EGGSLTII TALVDTGS+MDEVI+EEFKGTGN E+ L RKIA+KR+FPA+
Sbjct: 334 RFFGAARNVEEGGSLTIIATALVDTGSKMDEVIYEEFKGTGNMELHLSRKIAEKRVFPAI 393

Query: 362 DIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
           D  +SGTR+E+LL +  +LQK+++LR+IV  M  +D++EFLIDKL  TK N +FF +M +
Sbjct: 394 DFNRSGTRREELLAKPDELQKMWILRKIVHPMGETDSMEFLIDKLSMTKTNNEFFDAMRR 453

Query: 422 Q 422
           Q
Sbjct: 454 Q 454


>gi|89073867|ref|ZP_01160374.1| transcription termination factor Rho [Photobacterium sp. SKA34]
 gi|90581474|ref|ZP_01237268.1| transcription termination factor Rho [Vibrio angustum S14]
 gi|89050402|gb|EAR55903.1| transcription termination factor Rho [Photobacterium sp. SKA34]
 gi|90437335|gb|EAS62532.1| transcription termination factor Rho [Vibrio angustum S14]
          Length = 421

 Score =  589 bits (1518), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 281/419 (67%), Positives = 350/419 (83%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK++  +KL++  ESL +EN   +RKQ+++FSILK  +    +I G+GV+E+LQD
Sbjct: 1   MNLTELKSQPISKLVSLGESLGLENLARLRKQDIIFSILKQHAKSGEDIFGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P++GERYFALLKVN +N
Sbjct: 61  GFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTIAGKIRPPKDGERYFALLKVNEVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           +D P+  RNKI F+NLTPL+ + R  ME  N   +DI++RV+DL +PIGKGQR LIVAPP
Sbjct: 121 YDKPDNARNKILFENLTPLHANSRMRMERGNGSTEDITARVLDLASPIGKGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA SI  NHPEC L+VLLIDERPEEVT+MQR V+GEVI+STFDE A+RHV
Sbjct: 181 KAGKTMLLQNIAQSIAHNHPECELMVLLIDERPEEVTEMQRLVKGEVIASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANAL RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVIPSSGKVLTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TALVDTGS+MDEVI+EEFKGTGN E+ L RKIA+KR+FPA+DI
Sbjct: 301 FGAARNVEEGGSLTIIATALVDTGSKMDEVIYEEFKGTGNMELHLSRKIAEKRVFPAIDI 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQ 422
            +SGTR+E+LL +  +LQK+++LR+IV  M+ +D++EFLIDKL  TK N +FF +M +Q
Sbjct: 361 NRSGTRREELLAKADELQKMWILRKIVHPMSETDSMEFLIDKLSMTKTNDEFFDAMRRQ 419


>gi|189424091|ref|YP_001951268.1| transcription termination factor Rho [Geobacter lovleyi SZ]
 gi|189420350|gb|ACD94748.1| transcription termination factor Rho [Geobacter lovleyi SZ]
          Length = 415

 Score =  589 bits (1518), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 288/418 (68%), Positives = 347/418 (83%), Gaps = 3/418 (0%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M LQ+LKNK  ++L   A  L IE A+ +RKQ+L+F+IL   + ++  I GEGV+E+LQD
Sbjct: 1   MNLQDLKNKKISELNGIARDLSIEGASGLRKQDLIFAILNAQTEQNGSIYGEGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLR+PD NYL GPDDIYVSPSQI+ F+L+TGDTV G IR P+EGERYFALLKV  IN
Sbjct: 61  GFGFLRAPDYNYLPGPDDIYVSPSQIRRFNLRTGDTVSGQIRPPKEGERYFALLKVETIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           F+ PE  R+K  FDNLTPLYP+++  +E   P+N  +  RV++L++PIGKGQR LIVAPP
Sbjct: 121 FETPEAGRDKTLFDNLTPLYPEEKLKLE-TAPDNYGM--RVMELVSPIGKGQRGLIVAPP 177

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           RTGKT+L+QNIA+SI  NHPE YLIVLLIDERPEEVTDMQRSV GEV+SSTFDE A RHV
Sbjct: 178 RTGKTMLIQNIANSIAANHPEVYLIVLLIDERPEEVTDMQRSVNGEVVSSTFDEPATRHV 237

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++P SGKILTGGVDANALQ+PKRF
Sbjct: 238 QVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVLPPSGKILTGGVDANALQKPKRF 297

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TALVDTGS+MDEVIFEEFKGTGN E+ L+R++ +KR FPA+DI
Sbjct: 298 FGAARNIEEGGSLTIIATALVDTGSKMDEVIFEEFKGTGNMEVHLDRRLVEKRTFPAIDI 357

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            KSGTRKE+LL+ER  L ++++LR+I+  MN  DA+EFL+DKL +TK N+DF  SM+K
Sbjct: 358 NKSGTRKEELLIERTMLNRIWILRKILHPMNVVDAMEFLLDKLSETKTNQDFIDSMSK 415


>gi|117923453|ref|YP_864070.1| transcription termination factor Rho [Magnetococcus sp. MC-1]
 gi|117607209|gb|ABK42664.1| transcription termination factor Rho [Magnetococcus sp. MC-1]
          Length = 421

 Score =  588 bits (1515), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 283/417 (67%), Positives = 347/417 (83%), Gaps = 1/417 (0%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L++LK  + ++L   AE  +IEN + MR+QEL++++LK  S  + +I GEGV+EVLQD
Sbjct: 5   MNLKDLKAMNASQLSEIAEERKIENYSGMRRQELIYALLKTESENNGQIYGEGVLEVLQD 64

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLR+PD NYL GPDDIYVSPSQI+ F L+TGD VEG IRAP+E ERYFALL+V  IN
Sbjct: 65  GFGFLRAPDTNYLPGPDDIYVSPSQIRRFGLRTGDVVEGQIRAPKESERYFALLRVERIN 124

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           ++ P + RNKI FDNLTPLYPD+R  ME+ + E+ ++ +RV+DLI PIGKGQR LIVA P
Sbjct: 125 YEDPLKARNKILFDNLTPLYPDERLKMEIAD-ESSNLEARVMDLIVPIGKGQRGLIVAQP 183

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           RTGKT+L+Q IAHSI +NHP+  L+VLLIDERPEEVTDM+RSV+GEV+SSTFDE A RHV
Sbjct: 184 RTGKTMLMQKIAHSIAENHPDTVLLVLLIDERPEEVTDMKRSVKGEVVSSTFDEPATRHV 243

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMV+ KAK LVE+  DVVILLDSITRL RAYN + PSSGK+L+GG+DANALQRPKRF
Sbjct: 244 QVAEMVLEKAKRLVEHKRDVVILLDSITRLARAYNTVAPSSGKVLSGGIDANALQRPKRF 303

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTI+ TALVDTGSRMDEVIFEEFKGTGN E+ L+RK+ +KR FPA+DI
Sbjct: 304 FGAARNVEEGGSLTILATALVDTGSRMDEVIFEEFKGTGNMEVHLDRKLVEKRTFPAIDI 363

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
            KSGTRKE+LL ER +L K+++LRRI+  M   D++ FL+DKL+ TKDN +FF SMN
Sbjct: 364 AKSGTRKEELLTERDELSKLWVLRRILLPMGPLDSMSFLLDKLRATKDNSEFFESMN 420


>gi|59710665|ref|YP_203441.1| transcription termination factor Rho [Vibrio fischeri ES114]
 gi|59478766|gb|AAW84553.1| transcription termination factor [Vibrio fischeri ES114]
          Length = 419

 Score =  587 bits (1513), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 281/419 (67%), Positives = 347/419 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELKN+S + L+A  E+L +EN   +RKQ+++FSILK  +    +I G+GV+E+LQD
Sbjct: 1   MNLTELKNRSVSDLVALGETLGLENLARLRKQDIIFSILKQHAKSGEDIFGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P++GERYFALLKVNA+N
Sbjct: 61  GFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTIAGKIRPPKDGERYFALLKVNAVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
            D P+  RNKI F+NLTPL+ + R  ME  N   +DI++RV+DL +PIG+GQR LIVAPP
Sbjct: 121 HDRPDNARNKILFENLTPLHANDRLRMERGNGSTEDITARVLDLASPIGRGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA SI  NHPEC L+VLLIDERPEEVT+MQR V+GEV++STFDE A+RHV
Sbjct: 181 KAGKTMLLQNIAQSIAHNHPECELMVLLIDERPEEVTEMQRLVKGEVVASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANAL RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVIPSSGKVLTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TALVDTGS+MDEVI+EEFKGTGN E+ L RKIA+KR+FPA+D 
Sbjct: 301 FGAARNVEEGGSLTIIATALVDTGSKMDEVIYEEFKGTGNMELHLNRKIAEKRVFPAIDF 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQ 422
            +SGTR+E+LL +  +LQK+++LR+IV  M   DA+EFLIDKL  TK N +FF +M +Q
Sbjct: 361 NRSGTRREELLTKADELQKMWILRKIVHPMGEIDAMEFLIDKLSMTKTNDEFFDAMRRQ 419


>gi|237809400|ref|YP_002893840.1| transcription termination factor Rho [Tolumonas auensis DSM 9187]
 gi|237501661|gb|ACQ94254.1| transcription termination factor Rho [Tolumonas auensis DSM 9187]
          Length = 421

 Score =  586 bits (1511), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 277/420 (65%), Positives = 345/420 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELKN + ++L+   ES+ +EN   + K++++F+ILK  +    +I G+GV+E+LQD
Sbjct: 1   MNLTELKNTAVSELVHLGESMGLENLARLHKKDIIFAILKAHAKSGEDIFGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQ++ F+L+TGDT+ G IR P+EGERYFALLKV+ +N
Sbjct: 61  GFGFLRSADSSYLAGPDDIYVSPSQVRRFNLRTGDTISGKIRPPKEGERYFALLKVDTVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           +D PE  RNKI F+NLTPL+P KR  +E  N   +DI++R++DL +PIGKGQR LIVAPP
Sbjct: 121 YDRPENARNKILFENLTPLHPTKRLRLERGNGSTEDITARILDLASPIGKGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKTILLQNIA SI  NHP+C LIVLLIDERPEEVT+MQR V+GEV++STFDE A RHV
Sbjct: 181 KAGKTILLQNIAQSITSNHPDCELIVLLIDERPEEVTEMQRMVKGEVVASTFDEPATRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANAL RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVIPSSGKVLTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TALVDTGS+MDEVI+EEFKGTGN E+ L RKIA+KR++PA+DI
Sbjct: 301 FGAARNVEEGGSLTIIATALVDTGSKMDEVIYEEFKGTGNMELHLSRKIAEKRVYPAIDI 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQN 423
            +SGTR+E+LL    +LQK+++LR+IV  M   DA+EF+IDKL  TK N +FF SM +Q 
Sbjct: 361 TRSGTRREELLTAPDELQKMWILRKIVHPMGEIDAMEFMIDKLSLTKTNDEFFESMKRQQ 420


>gi|77920286|ref|YP_358101.1| transcription termination factor Rho [Pelobacter carbinolicus DSM
           2380]
 gi|77546369|gb|ABA89931.1| transcription termination factor Rho [Pelobacter carbinolicus DSM
           2380]
          Length = 415

 Score =  586 bits (1511), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 287/418 (68%), Positives = 348/418 (83%), Gaps = 3/418 (0%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L+ELK K  T+L A A+ L+++ A  MRKQ+L+F+IL   + ++  I GEGV+E+L D
Sbjct: 1   MNLKELKEKKITELAAIAKDLKLDGAAGMRKQDLIFTILNATAEKNGAIFGEGVLEILPD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLR+PDANYL GPDDIYVSPSQI+ F+L+TGDTV G IR P+EGERYFALLKV  +N
Sbjct: 61  GFGFLRAPDANYLPGPDDIYVSPSQIRRFNLRTGDTVSGQIRPPKEGERYFALLKVAEVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           F+ P   R+K  FDNLTPLYP++R  +E   P+N  +S RV+DL+ PIGKGQR LIVAPP
Sbjct: 121 FENPSVARDKTLFDNLTPLYPEERIVLEAA-PDN--LSMRVMDLVTPIGKGQRGLIVAPP 177

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           RTGKTILLQNIA+SI  NHPE YLIVLLIDERPEEVTDMQRSV+GEVISSTFDE A RHV
Sbjct: 178 RTGKTILLQNIANSIAVNHPEVYLIVLLIDERPEEVTDMQRSVKGEVISSTFDEPATRHV 237

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KA+ LVE+  DVVILLDSITRL RAYN ++P SGKIL+GGVD+NAL +PKRF
Sbjct: 238 QVAEMVIEKARRLVEHKRDVVILLDSITRLARAYNTVVPPSGKILSGGVDSNALHKPKRF 297

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TALVDTGS+MDEVIFEEFKGTGN E VL+R++ DKR FPA+D+
Sbjct: 298 FGAARNIEEGGSLTIIATALVDTGSKMDEVIFEEFKGTGNMEAVLDRRLVDKRTFPAIDV 357

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            KSGTR+E+LLV +  LQ++++LR+++SSMN  D++EFL++KL  TK N +FF SMN+
Sbjct: 358 NKSGTRREELLVGQTQLQRLWLLRKVLSSMNVVDSMEFLLEKLSATKTNDEFFESMNQ 415


>gi|39998198|ref|NP_954149.1| transcription termination factor Rho [Geobacter sulfurreducens PCA]
 gi|39985144|gb|AAR36499.1| transcription termination factor Rho [Geobacter sulfurreducens PCA]
          Length = 415

 Score =  586 bits (1510), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 286/418 (68%), Positives = 348/418 (83%), Gaps = 3/418 (0%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M LQELK K   +L A A+ L IE A+ +RKQ+L+F+IL   + ++  I GEGV+E L D
Sbjct: 1   MNLQELKGKKINELAAIAKGLNIEGASSLRKQDLIFAILNAQTEKNGMIFGEGVLECLPD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLR+PD NYL GPDDIYVSPSQI+ F+L TGDTV G IR P+EGERYFALLKV  +N
Sbjct: 61  GFGFLRAPDYNYLPGPDDIYVSPSQIRRFNLHTGDTVSGQIRPPKEGERYFALLKVETVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           F+ PE  R+KI FDNLTPLYPD++  +E   P+N  +S RV++L++PIGKGQR LIVAPP
Sbjct: 121 FEPPEVARDKILFDNLTPLYPDEKLKLE-TAPDN--MSMRVMELVSPIGKGQRGLIVAPP 177

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           RTGKT+L+QNIA+SI +NHPE YLIVLLIDERPEEVTDMQRSV+GEV+SSTFDE A RHV
Sbjct: 178 RTGKTMLIQNIANSIAENHPEVYLIVLLIDERPEEVTDMQRSVKGEVVSSTFDEPATRHV 237

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++P SGKILTGGVDANALQ+PKRF
Sbjct: 238 QVAEMVIEKAKRLVEHKRDVVILLDSITRLARAYNTVLPPSGKILTGGVDANALQKPKRF 297

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII +ALVDTGS+MDEVIFEEFKGTGN E+ L+RK+ +KR FPA+DI
Sbjct: 298 FGAARNIEEGGSLTIIASALVDTGSKMDEVIFEEFKGTGNMEVHLDRKLVEKRTFPAIDI 357

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            KSGTRKE+LLVE+  L ++++LR+++  MN  D++EFL++KL +TKDN+ F  SM++
Sbjct: 358 NKSGTRKEELLVEKSALNRIWILRKVLHPMNVVDSMEFLLEKLSETKDNQAFLDSMSR 415


>gi|218710957|ref|YP_002418578.1| transcription termination factor Rho [Vibrio splendidus LGP32]
 gi|218323976|emb|CAV20338.1| Transcription termination factor Rho [Vibrio splendidus LGP32]
          Length = 427

 Score =  586 bits (1510), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 279/421 (66%), Positives = 350/421 (83%)

Query: 2   SEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVL 61
           + M L ELKN+  ++L+  +ESL +EN   +RKQ+++FSILK  +    +I G+GV+E+L
Sbjct: 7   TTMNLTELKNRPVSELVKLSESLGLENQARLRKQDIIFSILKAHAKSGEDIFGDGVLEIL 66

Query: 62  QDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNA 121
           QDGFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGD++ G IR P++GERYFALLKVN 
Sbjct: 67  QDGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDSIGGKIRPPKDGERYFALLKVNT 126

Query: 122 INFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVA 181
           +N+D P+  RNKI F+NLTPL+ ++R  ME  N   +DI++R++DL +PIGKGQR LIVA
Sbjct: 127 VNYDKPDNARNKILFENLTPLHANERMVMEAGNGATEDITARILDLASPIGKGQRGLIVA 186

Query: 182 PPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAAR 241
           PP+ GKT+LLQNIA SI +NHPEC L+VLLIDERPEEVT+MQR V+GEVI+STFDE A+R
Sbjct: 187 PPKAGKTMLLQNIAQSIARNHPECELMVLLIDERPEEVTEMQRLVKGEVIASTFDEPASR 246

Query: 242 HVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPK 301
           HVQVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANAL RPK
Sbjct: 247 HVQVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVIPSSGKVLTGGVDANALHRPK 306

Query: 302 RFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAM 361
           RFFGAARN++EGGSLTII TALVDTGS+MDEVI+EEFKGTGN E+ L RKIA+KR+FPA+
Sbjct: 307 RFFGAARNVEEGGSLTIIATALVDTGSKMDEVIYEEFKGTGNMELHLNRKIAEKRVFPAI 366

Query: 362 DIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
           D  +SGTR+E+LL +  +LQK+++LR+IV  M   DA+EFLIDKL  TK N +FF +M +
Sbjct: 367 DFNRSGTRREELLTKNDELQKMWILRKIVHPMGEIDAMEFLIDKLAMTKTNDEFFDAMRR 426

Query: 422 Q 422
           Q
Sbjct: 427 Q 427


>gi|84393641|ref|ZP_00992392.1| transcription termination factor Rho [Vibrio splendidus 12B01]
 gi|84375709|gb|EAP92605.1| transcription termination factor Rho [Vibrio splendidus 12B01]
          Length = 419

 Score =  586 bits (1510), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 279/419 (66%), Positives = 350/419 (83%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELKN+  ++L+  +ESL +EN   +RKQ+++FSILK  +    +I G+GV+E+LQD
Sbjct: 1   MNLTELKNRPVSELVKLSESLGLENQARLRKQDIIFSILKAHAKSGEDIFGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGD++ G IR P++GERYFALLKVN +N
Sbjct: 61  GFGFLRSGDSSYLAGPDDIYVSPSQIRRFNLRTGDSIGGKIRPPKDGERYFALLKVNTVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           +D P+  RNKI F+NLTPL+ ++R  ME  N   +DI++R++DL +PIGKGQR LIVAPP
Sbjct: 121 YDKPDNARNKILFENLTPLHANERMVMEAGNGATEDITARILDLASPIGKGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA SI +NHPEC L+VLLIDERPEEVT+MQR V+GEVI+STFDE A+RHV
Sbjct: 181 KAGKTMLLQNIAQSIARNHPECELMVLLIDERPEEVTEMQRLVKGEVIASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANAL RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVIPSSGKVLTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TALVDTGS+MDEVI+EEFKGTGN E+ L RKIA+KR+FPA+D 
Sbjct: 301 FGAARNVEEGGSLTIIATALVDTGSKMDEVIYEEFKGTGNMELHLNRKIAEKRVFPAIDF 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQ 422
            +SGTR+E+LL +  +LQK+++LR+IV  M  +DA+EFLIDKL  TK N +FF +M +Q
Sbjct: 361 NRSGTRREELLTKPDELQKMWILRKIVHPMGETDAMEFLIDKLAMTKTNDEFFDAMRRQ 419


>gi|292493698|ref|YP_003529137.1| transcription termination factor Rho [Nitrosococcus halophilus Nc4]
 gi|291582293|gb|ADE16750.1| transcription termination factor Rho [Nitrosococcus halophilus Nc4]
          Length = 418

 Score =  586 bits (1510), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 277/418 (66%), Positives = 353/418 (84%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK KS ++LL  A+S+ +E  + +R+Q+L+F++LK  +    +I G GV+E+LQD
Sbjct: 1   MNLTELKTKSASELLDIAQSMGLEGMSRLRRQDLIFALLKAHAKNGEDIYGSGVLELLQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS  A+YLAGPDDIYVSPSQI+ F L+TGDT+EG IR P+EGERYFALLKVN IN
Sbjct: 61  GFGFLRSASASYLAGPDDIYVSPSQIRRFGLRTGDTIEGKIRPPKEGERYFALLKVNNIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           F+ PE+ RNK+ F+NLTPL+ ++R  +E  N   +D++ RVIDLIAPIGKGQR LIV+ P
Sbjct: 121 FEPPEQSRNKVLFENLTPLFANERLVLERGNGSTEDLTPRVIDLIAPIGKGQRGLIVSSP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           ++GKT++LQNIA SI  NHPECYLIVLLIDERPEEVT+M RSV+GEV+SSTFDE A+RHV
Sbjct: 181 KSGKTVMLQNIAQSITANHPECYLIVLLIDERPEEVTEMARSVRGEVVSSTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKRDVVILLDSITRLARAYNTVIPSSGKVLTGGVDANALQRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TAL+DTGSRMD+VI+EEFKGTGN EI LERK+++KRI+PA++I
Sbjct: 301 FGAARNLEEGGSLTIIATALIDTGSRMDDVIYEEFKGTGNMEIHLERKLSEKRIYPAINI 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            +SGTR+E+LL   +DLQK ++L ++++ M+ ++A+EFL+++LK+TK N +FF SM +
Sbjct: 361 NRSGTRREELLTNPEDLQKTWILHKLLAPMDEAEAMEFLLNRLKETKTNAEFFDSMKR 418


>gi|298507136|gb|ADI85859.1| transcription termination factor Rho [Geobacter sulfurreducens
           KN400]
          Length = 415

 Score =  586 bits (1510), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 286/418 (68%), Positives = 347/418 (83%), Gaps = 3/418 (0%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M LQELK K   +L A A  L IE A+ +RKQ+L+F+IL   + ++  I GEGV+E L D
Sbjct: 1   MNLQELKGKKINELAAIARGLNIEGASSLRKQDLIFAILNAQTEKNGMIFGEGVLECLPD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLR+PD NYL GPDDIYVSPSQI+ F+L TGDTV G IR P+EGERYFALLKV  +N
Sbjct: 61  GFGFLRAPDYNYLPGPDDIYVSPSQIRRFNLHTGDTVSGQIRPPKEGERYFALLKVETVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           F+ PE  R+KI FDNLTPLYPD++  +E   P+N  +S RV++L++PIGKGQR LIVAPP
Sbjct: 121 FEPPEVARDKILFDNLTPLYPDEKLKLE-TAPDN--MSMRVMELVSPIGKGQRGLIVAPP 177

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           RTGKT+L+QNIA+SI +NHPE YLIVLLIDERPEEVTDMQRSV+GEV+SSTFDE A RHV
Sbjct: 178 RTGKTMLIQNIANSIAENHPEVYLIVLLIDERPEEVTDMQRSVKGEVVSSTFDEPATRHV 237

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++P SGKILTGGVDANALQ+PKRF
Sbjct: 238 QVAEMVIEKAKRLVEHKRDVVILLDSITRLARAYNTVLPPSGKILTGGVDANALQKPKRF 297

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII +ALVDTGS+MDEVIFEEFKGTGN E+ L+RK+ +KR FPA+DI
Sbjct: 298 FGAARNIEEGGSLTIIASALVDTGSKMDEVIFEEFKGTGNMEVHLDRKLVEKRTFPAIDI 357

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            KSGTRKE+LLVE+  L ++++LR+++  MN  D++EFL++KL +TKDN+ F  SM++
Sbjct: 358 NKSGTRKEELLVEKSALNRIWILRKVLHPMNVVDSMEFLLEKLSETKDNQAFLDSMSR 415


>gi|86148271|ref|ZP_01066567.1| transcription termination factor Rho [Vibrio sp. MED222]
 gi|85833967|gb|EAQ52129.1| transcription termination factor Rho [Vibrio sp. MED222]
          Length = 419

 Score =  585 bits (1509), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 279/419 (66%), Positives = 349/419 (83%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELKN+  ++L+  +ESL +EN   +RKQ+++FSILK  +    +I G+GV+E+LQD
Sbjct: 1   MNLTELKNRPVSELVKLSESLGLENQARLRKQDIIFSILKAHAKSGEDIFGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGD++ G IR P++GERYFALLKVN +N
Sbjct: 61  GFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDSIGGKIRPPKDGERYFALLKVNTVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           +D P+  RNKI F+NLTPL+ ++R  ME  N   +DI++R++DL +PIGKGQR LIVAPP
Sbjct: 121 YDKPDNARNKILFENLTPLHANERMVMEAGNGATEDITARILDLASPIGKGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA SI +NHPEC L+VLLIDERPEEVT+MQR V+GEVI+STFDE A+RHV
Sbjct: 181 KAGKTMLLQNIAQSIARNHPECELMVLLIDERPEEVTEMQRLVKGEVIASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANAL RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVIPSSGKVLTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TALVDTGS+MDEVI+EEFKGTGN E+ L RKIA+KR+FPA+D 
Sbjct: 301 FGAARNVEEGGSLTIIATALVDTGSKMDEVIYEEFKGTGNMELHLNRKIAEKRVFPAIDF 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQ 422
            +SGTR+E+LL +  +LQK+++LR+IV  M   DA+EFLIDKL  TK N +FF +M +Q
Sbjct: 361 NRSGTRREELLTKNDELQKMWILRKIVHPMGEIDAMEFLIDKLAMTKTNDEFFDAMRRQ 419


>gi|209693769|ref|YP_002261697.1| transcription termination factor Rho [Aliivibrio salmonicida
           LFI1238]
 gi|208007720|emb|CAQ77833.1| transcription termination factor rho [Aliivibrio salmonicida
           LFI1238]
          Length = 419

 Score =  585 bits (1509), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 281/419 (67%), Positives = 347/419 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELKN+  + L+A  ESL +EN   +RKQ+++FSILK  +    +I G+GV+E+LQD
Sbjct: 1   MNLTELKNRPVSDLVALGESLGLENLARLRKQDIIFSILKQHAKSGEDIFGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D +YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P++GERYFALLKVNA+N
Sbjct: 61  GFGFLRSADCSYLAGPDDIYVSPSQIRRFNLRTGDTIGGKIRPPKDGERYFALLKVNAVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           +D P+  RNKI F+NLTPL+ + R  ME  N   +DI++R++DL +PIG+GQR LIVAPP
Sbjct: 121 YDRPDNARNKILFENLTPLHANDRLRMERGNGSTEDITARILDLASPIGRGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA SI  N+PEC L+VLLIDERPEEVT+MQR V+GEVI+STFDE A+RHV
Sbjct: 181 KAGKTMLLQNIAQSIAHNYPECELMVLLIDERPEEVTEMQRLVKGEVIASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGG+DANAL RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVIPSSGKVLTGGIDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TALVDTGS+MDEVI+EEFKGTGN E+ L RKIA+KRIFPA+D 
Sbjct: 301 FGAARNVEEGGSLTIIATALVDTGSKMDEVIYEEFKGTGNMELHLNRKIAEKRIFPAIDF 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQ 422
            +SGTR+E+LL +  +LQK+++LR+IV  M  SDA+EFLIDKL  TK N +FF +M +Q
Sbjct: 361 NRSGTRREELLTKTDELQKMWILRKIVHPMGESDAMEFLIDKLSMTKTNNEFFDAMRRQ 419


>gi|197334080|ref|YP_002154827.1| transcription termination factor Rho [Vibrio fischeri MJ11]
 gi|197315570|gb|ACH65017.1| transcription termination factor Rho [Vibrio fischeri MJ11]
          Length = 419

 Score =  585 bits (1507), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 280/419 (66%), Positives = 346/419 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELKN+  + L+A  E+L +EN   +RKQ+++FSILK  +    +I G+GV+E+LQD
Sbjct: 1   MNLTELKNRPVSDLVALGETLGLENLARLRKQDIIFSILKQHAKSGEDIFGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P++GERYFALLKVNA+N
Sbjct: 61  GFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTIAGKIRPPKDGERYFALLKVNAVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
            D P+  RNKI F+NLTPL+ + R  ME  N   +DI++RV+DL +PIG+GQR LIVAPP
Sbjct: 121 HDRPDNARNKILFENLTPLHANDRLRMERGNGSTEDITARVLDLASPIGRGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA SI  NHPEC L+VLLIDERPEEVT+MQR V+GEV++STFDE A+RHV
Sbjct: 181 KAGKTMLLQNIAQSIAHNHPECELMVLLIDERPEEVTEMQRLVKGEVVASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANAL RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVIPSSGKVLTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TALVDTGS+MDEVI+EEFKGTGN E+ L RKIA+KR+FPA+D 
Sbjct: 301 FGAARNVEEGGSLTIIATALVDTGSKMDEVIYEEFKGTGNMELHLNRKIAEKRVFPAIDF 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQ 422
            +SGTR+E+LL +  +LQK+++LR+IV  M   DA+EFLIDKL  TK N +FF +M +Q
Sbjct: 361 NRSGTRREELLTKADELQKMWILRKIVHPMGEIDAMEFLIDKLSMTKTNDEFFDAMRRQ 419


>gi|109900521|ref|YP_663776.1| transcription termination factor Rho [Pseudoalteromonas atlantica
           T6c]
 gi|109702802|gb|ABG42722.1| transcription termination factor Rho [Pseudoalteromonas atlantica
           T6c]
          Length = 433

 Score =  584 bits (1505), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 280/421 (66%), Positives = 345/421 (81%)

Query: 2   SEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVL 61
           + M L ELKNK  ++L+  AE + +EN    RKQ+++FSILK  +    +I G+GV+E+L
Sbjct: 11  TNMNLTELKNKPISELVGLAEKMGLENMARARKQDIIFSILKTHAKSGEDIFGDGVLEIL 70

Query: 62  QDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNA 121
           QDGFGFLRS DA+YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P++ ERYFALLK++ 
Sbjct: 71  QDGFGFLRSNDASYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKDSERYFALLKISE 130

Query: 122 INFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVA 181
           +NFD PE  RNKI F+NLTPL+ ++R  ME  N   +DI++RV+DL +PIG+GQR LIVA
Sbjct: 131 VNFDRPENARNKILFENLTPLHANERLVMERGNGSTEDITARVLDLASPIGRGQRGLIVA 190

Query: 182 PPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAAR 241
           PP+ GKT+LLQNIA SI  NHPEC L+VLLIDERPEEVT+MQR VQGEV++STFDE A+R
Sbjct: 191 PPKAGKTLLLQNIAQSIAANHPECLLMVLLIDERPEEVTEMQRLVQGEVVASTFDEPASR 250

Query: 242 HVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPK 301
           HVQVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANAL +PK
Sbjct: 251 HVQVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVIPSSGKVLTGGVDANALHKPK 310

Query: 302 RFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAM 361
           RFFGAARNI+EGGSLTII TAL+DTGS+MDEVI+EEFKGTGN E+ L RKIA+KR+FPA+
Sbjct: 311 RFFGAARNIEEGGSLTIIATALIDTGSKMDEVIYEEFKGTGNMELHLNRKIAEKRVFPAI 370

Query: 362 DIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
           D  +SGTR+E+LL    +LQK+++LR+IV  M+  DAIEFLI KL  TK N +FF +M K
Sbjct: 371 DYNRSGTRREELLTTPDELQKMWILRKIVHEMSEIDAIEFLIGKLSMTKTNNEFFTAMRK 430

Query: 422 Q 422
           Q
Sbjct: 431 Q 431


>gi|149191363|ref|ZP_01869615.1| transcription termination factor Rho [Vibrio shilonii AK1]
 gi|148834780|gb|EDL51765.1| transcription termination factor Rho [Vibrio shilonii AK1]
          Length = 419

 Score =  584 bits (1505), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 278/419 (66%), Positives = 347/419 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELKN+  ++L+   ESL +EN   +RKQ+++F+ILK  +    +I G+GV+E+LQD
Sbjct: 1   MNLTELKNRPVSELVKLGESLGLENLARLRKQDIIFAILKAHAKSGEDIFGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGD++ G IR P++GERYFALLKVN +N
Sbjct: 61  GFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDSIAGKIRPPKDGERYFALLKVNTVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
            D P+  RNKI F+NLTPL+ ++R  ME  N   +DI++RV+DL +PIGKGQR LIVAPP
Sbjct: 121 DDKPDNARNKILFENLTPLHANERMTMERGNGSTEDITARVLDLASPIGKGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA SI  NHPEC L+VLLIDERPEEVT+MQR V+GEV++STFDE A+RHV
Sbjct: 181 KAGKTMLLQNIAQSIAHNHPECELMVLLIDERPEEVTEMQRLVKGEVVASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANAL RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVVPSSGKVLTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TALVDTGS+MDEVI+EEFKGTGN E+ L RKIA+KR+FPA+D 
Sbjct: 301 FGAARNVEEGGSLTIIATALVDTGSKMDEVIYEEFKGTGNMELHLNRKIAEKRVFPAIDF 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQ 422
            +SGTR+E+LL +  +LQK+++LR+IV  M  +DA+EFLIDKL  TK N +FF +M +Q
Sbjct: 361 NRSGTRREELLTKSDELQKMWILRKIVHPMGETDAMEFLIDKLAMTKTNDEFFDAMRRQ 419


>gi|104784235|ref|YP_610733.1| transcription termination factor Rho [Pseudomonas entomophila L48]
 gi|95113222|emb|CAK17950.1| transcription termination factor [Pseudomonas entomophila L48]
          Length = 419

 Score =  584 bits (1505), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 281/419 (67%), Positives = 349/419 (83%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK K  T LL  AE + IEN    RKQ+++F++LK  +    EI G+GV+E+LQD
Sbjct: 1   MNLTELKQKPITDLLEMAEQMGIENMARSRKQDVIFALLKKHAKSGEEISGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS DA+YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P+EGERYFALLKV+ IN
Sbjct: 61  GFGFLRSADASYLAGPDDIYVSPSQIRRFNLRTGDTIVGKIRPPKEGERYFALLKVDTIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           FD PE  +NKI F+NLTPL+P+KR  ME  N   +D++ RVIDL APIGKGQR LIVAPP
Sbjct: 121 FDRPENAKNKILFENLTPLFPNKRLKMEAGNGSTEDLTGRVIDLCAPIGKGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKTI+LQNIA +I +N+PEC+LIVLLIDERPEEVT+MQR+V+GEV++STFDE   RHV
Sbjct: 181 KAGKTIMLQNIAANITRNNPECHLIVLLIDERPEEVTEMQRTVRGEVVASTFDEPPTRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDA+AL++PKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVIPSSGKVLTGGVDAHALEKPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TALV+TGS+MDEVI+EEFKGTGN E+ L+R+IA+KR+FPA++I
Sbjct: 301 FGAARNIEEGGSLTIIATALVETGSKMDEVIYEEFKGTGNMELPLDRRIAEKRVFPAINI 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQ 422
            KSGTR+E+LL    +LQ++++LR+++  M+   AIEFL+DKLKQTK N +FF SM ++
Sbjct: 361 NKSGTRREELLTADDELQRMWILRKLLHPMDEIAAIEFLVDKLKQTKTNDEFFLSMKRK 419


>gi|332308443|ref|YP_004436294.1| transcription termination factor Rho [Glaciecola agarilytica
           4H-3-7+YE-5]
 gi|332175772|gb|AEE25026.1| transcription termination factor Rho [Glaciecola agarilytica
           4H-3-7+YE-5]
          Length = 433

 Score =  583 bits (1504), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 280/421 (66%), Positives = 345/421 (81%)

Query: 2   SEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVL 61
           + M L ELKNK  ++L+  AE + +EN    RKQ+++FSILK  +    +I G GV+E+L
Sbjct: 11  TNMNLTELKNKPISELVGLAEKMGLENMARARKQDIIFSILKTHAKSGEDIFGNGVLEIL 70

Query: 62  QDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNA 121
           QDGFGFLRS DA+YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P++ ERYFALLK++ 
Sbjct: 71  QDGFGFLRSNDASYLAGPDDIYVSPSQIRRFNLRTGDTIAGKIRPPKDSERYFALLKISE 130

Query: 122 INFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVA 181
           +NFD PE  RNKI F+NLTPL+ ++R  ME  N   +DI++RV+DL +PIG+GQR LIVA
Sbjct: 131 VNFDRPENSRNKILFENLTPLHANERLVMERGNGSTEDITARVLDLASPIGRGQRGLIVA 190

Query: 182 PPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAAR 241
           PP+ GKT+LLQNIA SI  NHPEC L+VLLIDERPEEVT+MQR VQGEV++STFDE A+R
Sbjct: 191 PPKAGKTLLLQNIAQSIAANHPECLLMVLLIDERPEEVTEMQRLVQGEVVASTFDEPASR 250

Query: 242 HVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPK 301
           HVQVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANAL +PK
Sbjct: 251 HVQVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVIPSSGKVLTGGVDANALHKPK 310

Query: 302 RFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAM 361
           RFFGAARNI+EGGSLTII TAL+DTGS+MDEVI+EEFKGTGN E+ L RKIA+KR+FPA+
Sbjct: 311 RFFGAARNIEEGGSLTIIATALIDTGSKMDEVIYEEFKGTGNMELHLNRKIAEKRVFPAI 370

Query: 362 DIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
           D  +SGTR+E+LL  + +LQK+++LR+IV  M+  DAIEFLI KL  TK N +FF +M K
Sbjct: 371 DYNRSGTRREELLTTQDELQKMWILRKIVHEMSEIDAIEFLIGKLAMTKTNDEFFTAMRK 430

Query: 422 Q 422
           Q
Sbjct: 431 Q 431


>gi|225874067|ref|YP_002755526.1| transcription termination factor Rho [Acidobacterium capsulatum
           ATCC 51196]
 gi|225793779|gb|ACO33869.1| transcription termination factor Rho [Acidobacterium capsulatum
           ATCC 51196]
          Length = 416

 Score =  583 bits (1504), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 280/417 (67%), Positives = 348/417 (83%), Gaps = 3/417 (0%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M + ELK K+ T+L   A SL+I  A+ +RKQ+L+F IL+  S ++  I  EGV+E+L D
Sbjct: 1   MTIAELKEKNITELSRIARSLDIPGASGLRKQDLIFKILQAQSEKEGHIFAEGVLEILPD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           G+GFLRSPD NYL GPDDIYVSPSQI+ F LKTGDT+ G++R P EGE+YFAL+K+ AIN
Sbjct: 61  GYGFLRSPDYNYLPGPDDIYVSPSQIRKFDLKTGDTISGNVRPPHEGEKYFALVKIEAIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           F+ PE  RNKI FDNLTPLYP++R  ME       +IS RV+DL+ PIGKGQR LIVAPP
Sbjct: 121 FESPEETRNKILFDNLTPLYPEERIKMETVR---DNISGRVMDLLTPIGKGQRGLIVAPP 177

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           RTGKT+LLQ+IA+SI  NHPE  LIVLLIDERPEEVTDMQRSV+GEVISSTFDE AARHV
Sbjct: 178 RTGKTMLLQSIANSITANHPEVALIVLLIDERPEEVTDMQRSVKGEVISSTFDEPAARHV 237

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++P SGK+L+GGVD+NALQRPKRF
Sbjct: 238 QVAEMVIEKAKRLVEHKRDVVILLDSITRLARAYNTIVPPSGKVLSGGVDSNALQRPKRF 297

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TALVDTGSRMDEVIFEEFKGTGN E++L+RK+ DKR+FPA+DI
Sbjct: 298 FGAARNIEEGGSLTIIATALVDTGSRMDEVIFEEFKGTGNMEVILDRKLVDKRVFPAIDI 357

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
            +SGTRKE+LL+ ++DLQ++++LR++++ ++  +A+E L+DKL +T++N +F  +M+
Sbjct: 358 QRSGTRKEELLIPKEDLQRIWVLRKVLNPLSPVEAMELLVDKLGKTRNNAEFLLNMS 414


>gi|78221597|ref|YP_383344.1| transcription termination factor Rho [Geobacter metallireducens
           GS-15]
 gi|78192852|gb|ABB30619.1| transcription termination factor Rho [Geobacter metallireducens
           GS-15]
          Length = 415

 Score =  583 bits (1502), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 284/418 (67%), Positives = 346/418 (82%), Gaps = 3/418 (0%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M LQELK K   +L A A+ L IE A+ +RKQ+L+F+IL   + ++  I GEGV+E L D
Sbjct: 1   MNLQELKGKKINELAAIAKGLNIEGASSLRKQDLIFAILNAQTEKNGMIFGEGVLECLPD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLR+PD NYL GPDDIYVSPSQI+ F+L TGDTV G IR P+EGERYFALLKV  +N
Sbjct: 61  GFGFLRAPDYNYLPGPDDIYVSPSQIRRFNLHTGDTVSGQIRPPKEGERYFALLKVETVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           F+ PE  R+KI FDNLTPLYPD++  +E   P+N  +  RV++L++PIGKGQR LIVAPP
Sbjct: 121 FEPPEVARDKILFDNLTPLYPDEKLKLE-TAPDN--MPMRVLELVSPIGKGQRGLIVAPP 177

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           RTGKT+L+QNIA+SI +NHPE YLIVLLIDERPEEVTDMQRSV+GEV+SSTFDE A RHV
Sbjct: 178 RTGKTMLIQNIANSIAENHPEVYLIVLLIDERPEEVTDMQRSVRGEVVSSTFDEPATRHV 237

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++P SGKILTGGVDANALQ+PKRF
Sbjct: 238 QVAEMVIEKAKRLVEHKRDVVILLDSITRLARAYNTVLPPSGKILTGGVDANALQKPKRF 297

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII +ALVDTGS+MDEVIFEEFKGTGN E+ L+RK+ +KR FPA+DI
Sbjct: 298 FGAARNIEEGGSLTIIASALVDTGSKMDEVIFEEFKGTGNMEVHLDRKLVEKRTFPAIDI 357

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            KSGTRKE+LLVE+  L + ++LR+++  MN  D++EFL++KL +TK N++F  SM++
Sbjct: 358 NKSGTRKEELLVEKGSLNRTWILRKVLHPMNVVDSMEFLLEKLSETKSNQEFLDSMSR 415


>gi|26991890|ref|NP_747315.1| transcription termination factor Rho [Pseudomonas putida KT2440]
 gi|148550323|ref|YP_001270425.1| transcription termination factor Rho [Pseudomonas putida F1]
 gi|167036262|ref|YP_001671493.1| transcription termination factor Rho [Pseudomonas putida GB-1]
 gi|170724194|ref|YP_001751882.1| transcription termination factor Rho [Pseudomonas putida W619]
 gi|24987011|gb|AAN70779.1|AE016721_12 transcription termination factor Rho [Pseudomonas putida KT2440]
 gi|148514381|gb|ABQ81241.1| transcription termination factor Rho [Pseudomonas putida F1]
 gi|166862750|gb|ABZ01158.1| transcription termination factor Rho [Pseudomonas putida GB-1]
 gi|169762197|gb|ACA75513.1| transcription termination factor Rho [Pseudomonas putida W619]
 gi|313501192|gb|ADR62558.1| Rho [Pseudomonas putida BIRD-1]
          Length = 419

 Score =  583 bits (1502), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 280/419 (66%), Positives = 349/419 (83%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK K  T LL  AE + IEN    RKQ+++F++LK  +    EI G+GV+E+LQD
Sbjct: 1   MNLTELKQKPITDLLEMAEQMGIENMARSRKQDVIFALLKKHAKSGEEISGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS DA+YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P+EGERYFALLKV+ IN
Sbjct: 61  GFGFLRSADASYLAGPDDIYVSPSQIRRFNLRTGDTIVGKIRPPKEGERYFALLKVDTIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           FD PE  +NKI F+NLTPL+P+KR  ME  N   +D++ RVIDL APIGKGQR LIVAPP
Sbjct: 121 FDRPENAKNKILFENLTPLFPNKRLKMEAGNGSTEDLTGRVIDLCAPIGKGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKTI+LQNIA +I +N+PEC+LIVLLIDERPEEVT+MQR+V+GEV++STFDE   RHV
Sbjct: 181 KAGKTIMLQNIAANITRNNPECHLIVLLIDERPEEVTEMQRTVRGEVVASTFDEPPTRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDA+AL++PKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVIPSSGKVLTGGVDAHALEKPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TALV+TGS+MDEVI+EEFKGTGN E+ L+R+IA+KR+FPA++I
Sbjct: 301 FGAARNIEEGGSLTIIATALVETGSKMDEVIYEEFKGTGNMELPLDRRIAEKRVFPAINI 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQ 422
            +SGTR+E+LL    +LQ++++LR+++  M+   AIEFL+DKLKQTK N +FF SM ++
Sbjct: 361 NRSGTRREELLTADDELQRMWILRKLLHPMDEIAAIEFLVDKLKQTKTNDEFFLSMKRK 419


>gi|261250044|ref|ZP_05942621.1| transcription termination factor Rho [Vibrio orientalis CIP 102891]
 gi|260939548|gb|EEX95533.1| transcription termination factor Rho [Vibrio orientalis CIP 102891]
          Length = 427

 Score =  582 bits (1501), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 279/421 (66%), Positives = 347/421 (82%)

Query: 2   SEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVL 61
           + M L ELKN+  + L+   ESL +EN   +RKQ+++F+ILK  +    +I G+GV+E+L
Sbjct: 7   TTMNLTELKNRPVSDLVKLGESLGLENLARLRKQDIIFAILKAHAKSGEDIFGDGVLEIL 66

Query: 62  QDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNA 121
           QDGFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGD++ G IR P++GERYFALLKVN 
Sbjct: 67  QDGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDSIAGKIRPPKDGERYFALLKVNT 126

Query: 122 INFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVA 181
           +N D P+  RNKI F+NLTPL+ ++R  ME  N   +DI++RV+DL +PIGKGQR LIVA
Sbjct: 127 VNADKPDNARNKILFENLTPLHANERMVMERGNGSTEDITARVLDLASPIGKGQRGLIVA 186

Query: 182 PPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAAR 241
           PP+ GKT+LLQNIA SI  NHPEC L+VLLIDERPEEVT+MQR V+GEVI+STFDE A+R
Sbjct: 187 PPKAGKTMLLQNIAQSIAYNHPECELMVLLIDERPEEVTEMQRLVKGEVIASTFDEPASR 246

Query: 242 HVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPK 301
           HVQVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANAL RPK
Sbjct: 247 HVQVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVVPSSGKVLTGGVDANALHRPK 306

Query: 302 RFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAM 361
           RFFGAARN++EGGSLTI+ TALVDTGS+MDEVI+EEFKGTGN EI L RKIA+KR+FPA+
Sbjct: 307 RFFGAARNVEEGGSLTILATALVDTGSKMDEVIYEEFKGTGNMEIHLNRKIAEKRVFPAI 366

Query: 362 DIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
           D  +SGTR+E+LL + ++LQK+++LR+IV  M   DA+EFLIDKL  TK N +FF +M +
Sbjct: 367 DFNRSGTRREELLTKNEELQKMWILRKIVHPMGEIDAMEFLIDKLAMTKTNDEFFDAMRR 426

Query: 422 Q 422
           Q
Sbjct: 427 Q 427


>gi|15640335|ref|NP_229962.1| transcription termination factor Rho [Vibrio cholerae O1 biovar El
           Tor str. N16961]
 gi|121591054|ref|ZP_01678367.1| transcription termination factor Rho [Vibrio cholerae 2740-80]
 gi|147675619|ref|YP_001218577.1| transcription termination factor Rho [Vibrio cholerae O395]
 gi|153803141|ref|ZP_01957727.1| transcription termination factor Rho [Vibrio cholerae MZO-3]
 gi|153819595|ref|ZP_01972262.1| transcription termination factor Rho [Vibrio cholerae NCTC 8457]
 gi|153822834|ref|ZP_01975501.1| transcription termination factor Rho [Vibrio cholerae B33]
 gi|153827153|ref|ZP_01979820.1| transcription termination factor Rho [Vibrio cholerae MZO-2]
 gi|153831011|ref|ZP_01983678.1| transcription termination factor Rho [Vibrio cholerae 623-39]
 gi|227080521|ref|YP_002809072.1| transcription termination factor Rho [Vibrio cholerae M66-2]
 gi|229506896|ref|ZP_04396404.1| transcription termination factor Rho [Vibrio cholerae BX 330286]
 gi|229509269|ref|ZP_04398752.1| transcription termination factor Rho [Vibrio cholerae B33]
 gi|229512685|ref|ZP_04402153.1| transcription termination factor Rho [Vibrio cholerae TMA 21]
 gi|229516213|ref|ZP_04405661.1| transcription termination factor Rho [Vibrio cholerae RC9]
 gi|229520974|ref|ZP_04410395.1| transcription termination factor Rho [Vibrio cholerae TM 11079-80]
 gi|229527198|ref|ZP_04416591.1| transcription termination factor Rho [Vibrio cholerae 12129(1)]
 gi|229606409|ref|YP_002877057.1| transcription termination factor Rho [Vibrio cholerae MJ-1236]
 gi|254286222|ref|ZP_04961181.1| transcription termination factor Rho [Vibrio cholerae AM-19226]
 gi|254851441|ref|ZP_05240791.1| transcription termination factor Rho [Vibrio cholerae MO10]
 gi|255744105|ref|ZP_05418059.1| transcription termination factor Rho [Vibrio cholera CIRS 101]
 gi|258620669|ref|ZP_05715706.1| transcription termination factor Rho [Vibrio mimicus VM573]
 gi|258623757|ref|ZP_05718715.1| transcription termination factor Rho [Vibrio mimicus VM603]
 gi|262161997|ref|ZP_06031014.1| transcription termination factor Rho [Vibrio cholerae INDRE 91/1]
 gi|262163843|ref|ZP_06031583.1| transcription termination factor Rho [Vibrio mimicus VM223]
 gi|262405030|ref|ZP_06081582.1| transcription termination factor Rho [Vibrio sp. RC586]
 gi|297581769|ref|ZP_06943691.1| transcription termination factor Rho [Vibrio cholerae RC385]
 gi|298500939|ref|ZP_07010741.1| transcription termination factor Rho [Vibrio cholerae MAK 757]
 gi|9654720|gb|AAF93481.1| transcription termination factor Rho [Vibrio cholerae O1 biovar El
           Tor str. N16961]
 gi|121547087|gb|EAX57222.1| transcription termination factor Rho [Vibrio cholerae 2740-80]
 gi|124121332|gb|EAY40075.1| transcription termination factor Rho [Vibrio cholerae MZO-3]
 gi|126509851|gb|EAZ72445.1| transcription termination factor Rho [Vibrio cholerae NCTC 8457]
 gi|126519652|gb|EAZ76875.1| transcription termination factor Rho [Vibrio cholerae B33]
 gi|146317502|gb|ABQ22041.1| transcription termination factor Rho [Vibrio cholerae O395]
 gi|148873503|gb|EDL71638.1| transcription termination factor Rho [Vibrio cholerae 623-39]
 gi|149738950|gb|EDM53268.1| transcription termination factor Rho [Vibrio cholerae MZO-2]
 gi|150423637|gb|EDN15579.1| transcription termination factor Rho [Vibrio cholerae AM-19226]
 gi|227008409|gb|ACP04621.1| transcription termination factor Rho [Vibrio cholerae M66-2]
 gi|227012166|gb|ACP08376.1| transcription termination factor Rho [Vibrio cholerae O395]
 gi|229335206|gb|EEO00690.1| transcription termination factor Rho [Vibrio cholerae 12129(1)]
 gi|229341859|gb|EEO06860.1| transcription termination factor Rho [Vibrio cholerae TM 11079-80]
 gi|229346639|gb|EEO11609.1| transcription termination factor Rho [Vibrio cholerae RC9]
 gi|229350195|gb|EEO15147.1| transcription termination factor Rho [Vibrio cholerae TMA 21]
 gi|229353584|gb|EEO18521.1| transcription termination factor Rho [Vibrio cholerae B33]
 gi|229356001|gb|EEO20920.1| transcription termination factor Rho [Vibrio cholerae BX 330286]
 gi|229369064|gb|ACQ59487.1| transcription termination factor Rho [Vibrio cholerae MJ-1236]
 gi|254847146|gb|EET25560.1| transcription termination factor Rho [Vibrio cholerae MO10]
 gi|255738370|gb|EET93761.1| transcription termination factor Rho [Vibrio cholera CIRS 101]
 gi|258583954|gb|EEW08745.1| transcription termination factor Rho [Vibrio mimicus VM603]
 gi|258587184|gb|EEW11896.1| transcription termination factor Rho [Vibrio mimicus VM573]
 gi|262027823|gb|EEY46488.1| transcription termination factor Rho [Vibrio mimicus VM223]
 gi|262028375|gb|EEY47031.1| transcription termination factor Rho [Vibrio cholerae INDRE 91/1]
 gi|262348869|gb|EEY98010.1| transcription termination factor Rho [Vibrio sp. RC586]
 gi|297534176|gb|EFH73015.1| transcription termination factor Rho [Vibrio cholerae RC385]
 gi|297540443|gb|EFH76502.1| transcription termination factor Rho [Vibrio cholerae MAK 757]
          Length = 419

 Score =  582 bits (1501), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 279/419 (66%), Positives = 345/419 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELKN   + L+   ESL +EN   +RKQ+++F+ILK  +    +I G+GV+E+LQD
Sbjct: 1   MNLTELKNTPVSDLVKLGESLGLENLARLRKQDIIFAILKAHAKSGEDIFGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGD++ G IR P+EGERYFALLKVN +N
Sbjct: 61  GFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDSIAGKIRPPKEGERYFALLKVNTVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
            D P+  RNKI F+NLTPL+ ++R  ME  N   +DI++RV+DL APIGKGQR LIVAPP
Sbjct: 121 DDRPDNARNKILFENLTPLHANERMVMERGNGSTEDITARVLDLAAPIGKGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA SI  NHPEC L+VLLIDERPEEVT+MQR V+GEV++STFDE A+RHV
Sbjct: 181 KAGKTMLLQNIAQSIASNHPECVLMVLLIDERPEEVTEMQRLVKGEVVASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++P+SGK+LTGGVDANAL RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVVPASGKVLTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TALVDTGS+MDEVI+EEFKGTGN E+ L RKIA+KR+FPA+D 
Sbjct: 301 FGAARNVEEGGSLTIIATALVDTGSKMDEVIYEEFKGTGNMELHLNRKIAEKRVFPAIDF 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQ 422
            +SGTR+E+LL +  +LQK+++LR+IV  M  +DA+EFLIDKL  TK N +FF +M +Q
Sbjct: 361 NRSGTRREELLTKTDELQKMWILRKIVHPMGETDAMEFLIDKLAMTKTNDEFFDAMRRQ 419


>gi|152997987|ref|YP_001342822.1| transcription termination factor Rho [Marinomonas sp. MWYL1]
 gi|150838911|gb|ABR72887.1| transcription termination factor Rho [Marinomonas sp. MWYL1]
          Length = 421

 Score =  582 bits (1501), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 278/420 (66%), Positives = 350/420 (83%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L +LK KS  +LL  A  + IEN    RKQ+++FSILK  +    +I G+G++E+LQD
Sbjct: 1   MNLTDLKQKSVHELLEIAAEMGIENMARSRKQDVIFSILKRHAKGGEDIYGDGILEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSPD +YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P++GERYFALLKV+ IN
Sbjct: 61  GFGFLRSPDCSYLAGPDDIYVSPSQIRRFNLRTGDTIAGKIRPPKDGERYFALLKVSEIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           FD PE VRNKI F+NLTPL+PD+R  ME  N   +D++SR+IDL+AP+GKGQR+L+V+PP
Sbjct: 121 FDKPESVRNKILFENLTPLFPDERLLMEAGNGSTEDVTSRIIDLVAPMGKGQRALVVSPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT +LQNIA++I +N+PEC+LIVLLIDERPEEVT+M R+V+GEV++STFDE   RHV
Sbjct: 181 KAGKTFMLQNIANAITRNNPECHLIVLLIDERPEEVTEMSRTVRGEVVASTFDEPPTRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMV+ KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANAL+RPKRF
Sbjct: 241 QVAEMVLEKAKRLVEHKRDVVILLDSITRLARAYNTVIPSSGKVLTGGVDANALERPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TALVDTGS+MDEVIFEEFKGTGNSE+ L+RKIA+KR FPA++I
Sbjct: 301 FGAARNIEEGGSLTIIATALVDTGSKMDEVIFEEFKGTGNSELHLDRKIAEKRTFPAINI 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQN 423
            +SGTR+EDLL    +LQ++++LR++++ M    A EFLID+LK T+ N +FF SM  +N
Sbjct: 361 RRSGTRREDLLTSEDELQRMWILRKLLNPMEDVAATEFLIDRLKVTQTNDEFFESMKGKN 420


>gi|300113236|ref|YP_003759811.1| transcription termination factor Rho [Nitrosococcus watsonii C-113]
 gi|299539173|gb|ADJ27490.1| transcription termination factor Rho [Nitrosococcus watsonii C-113]
          Length = 418

 Score =  582 bits (1500), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 274/418 (65%), Positives = 352/418 (84%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK KS ++LL  A+S+ +E  + +R+Q+L+F++LK  +    +I G GV+E+LQD
Sbjct: 1   MNLTELKTKSASELLDIAQSMGLEGISRLRRQDLIFALLKAHAKNGEDIYGNGVLELLQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS  A+YLAGPDDIYVSPSQI+ F L+TGDTVEG IR P+EGERYFALLKV++IN
Sbjct: 61  GFGFLRSASASYLAGPDDIYVSPSQIRRFGLRTGDTVEGKIRPPKEGERYFALLKVSSIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           F+ PE+ RNK+ F+NLTPL+ ++R  +E  N   +D++ RVIDL+ P+GKGQR LIV+ P
Sbjct: 121 FEPPEQSRNKVLFENLTPLFANERLVLERGNGSTEDLTPRVIDLVVPVGKGQRGLIVSSP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           ++GKT++LQNIA SI  NHPECYLIVLLIDERPEEVT+M RSV+GEV+SSTFDE A+RHV
Sbjct: 181 KSGKTVMLQNIAQSIAANHPECYLIVLLIDERPEEVTEMARSVRGEVVSSTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKRDVVILLDSITRLARAYNTVIPSSGKVLTGGVDANALQRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TAL+DTGSRMD+VI+EEFKGTGN EI LERK+A+KRI+PA++I
Sbjct: 301 FGAARNLEEGGSLTIIATALIDTGSRMDDVIYEEFKGTGNMEIHLERKLAEKRIYPAINI 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            +SGTR+E+LL   ++LQK ++L ++++ M+ ++A+EFL+ +LK+TK N +FF SM +
Sbjct: 361 SRSGTRREELLTHPENLQKTWILHKLLAPMDEAEAMEFLLSRLKETKTNDEFFDSMRR 418


>gi|153834688|ref|ZP_01987355.1| transcription termination factor Rho [Vibrio harveyi HY01]
 gi|148868884|gb|EDL67944.1| transcription termination factor Rho [Vibrio harveyi HY01]
          Length = 427

 Score =  582 bits (1500), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 278/421 (66%), Positives = 348/421 (82%)

Query: 2   SEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVL 61
           + M L ELKN+  + L+   ESL +EN   +RKQ+++F+ILK  +    +I G+GV+E+L
Sbjct: 7   TTMNLTELKNRPVSDLVKLGESLGLENLARLRKQDIIFAILKAHAKGGEDIFGDGVLEIL 66

Query: 62  QDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNA 121
           QDGFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGD++ G IR P++GERYFALLKVN 
Sbjct: 67  QDGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDSIAGKIRPPKDGERYFALLKVNT 126

Query: 122 INFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVA 181
           +N D P+  RNKI F+NLTPL+ ++R  ME  N   +DI++RV+DL +PIGKGQR LIVA
Sbjct: 127 VNDDKPDNARNKILFENLTPLHANERMVMERGNGSTEDITARVLDLASPIGKGQRGLIVA 186

Query: 182 PPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAAR 241
           PP+ GKT+LLQNIA SI  NHPEC L+VLLIDERPEEVT+MQR V+GEV++STFDE A+R
Sbjct: 187 PPKAGKTMLLQNIAQSIAYNHPECELMVLLIDERPEEVTEMQRLVKGEVVASTFDEPASR 246

Query: 242 HVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPK 301
           HVQVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANAL RPK
Sbjct: 247 HVQVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVVPSSGKVLTGGVDANALHRPK 306

Query: 302 RFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAM 361
           RFFGAARN++EGGSLTI+ TALVDTGS+MDEVI+EEFKGTGN EI L RKIA+KR+FPA+
Sbjct: 307 RFFGAARNVEEGGSLTILATALVDTGSKMDEVIYEEFKGTGNMEIHLNRKIAEKRVFPAI 366

Query: 362 DIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
           D  +SGTR+E+LL + ++LQK+++LR+IV  M  +DA+EFLIDKL  TK N +FF +M +
Sbjct: 367 DFNRSGTRREELLTKNEELQKMWILRKIVHPMGETDAMEFLIDKLAMTKTNDEFFDAMRR 426

Query: 422 Q 422
           Q
Sbjct: 427 Q 427


>gi|145301124|ref|YP_001143965.1| transcription termination factor Rho [Aeromonas salmonicida subsp.
           salmonicida A449]
 gi|142853896|gb|ABO92217.1| transcription termination factor Rho [Aeromonas salmonicida subsp.
           salmonicida A449]
          Length = 421

 Score =  582 bits (1500), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 281/419 (67%), Positives = 343/419 (81%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELKN   ++L+   ES+ +EN     K++++F+ILK  +    +I G+GV+E+L D
Sbjct: 1   MNLTELKNTPVSELVKLGESMGLENLARAHKKDIIFAILKAHAKGGEDIFGDGVLEILTD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D +YLAGPDDIYVSPSQI+ F+L+TGDTV G IR P+EGERYFALLKVN +N
Sbjct: 61  GFGFLRSADGSYLAGPDDIYVSPSQIRRFNLRTGDTVSGKIRPPKEGERYFALLKVNEVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           +D PE VRNKI F+NLTPL+ ++R  ME  N   +DI++RV+DL +PIGKGQR LIVAPP
Sbjct: 121 YDRPENVRNKILFENLTPLHANERLRMERGNGSTEDITARVLDLASPIGKGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA SI  NHP+C LIVLLIDERPEEVT+MQR V+GEVI+STFDE A+RHV
Sbjct: 181 KAGKTMLLQNIAQSIAYNHPDCELIVLLIDERPEEVTEMQRMVKGEVIASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVA+MVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANAL RPKRF
Sbjct: 241 QVADMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVIPSSGKVLTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TALVDTGS+MDEVI+EEFKGTGN E+ L RKIA+KRI+PA+DI
Sbjct: 301 FGAARNVEEGGSLTIIATALVDTGSKMDEVIYEEFKGTGNMELHLSRKIAEKRIYPAIDI 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQ 422
            +SGTRKE+LL    +LQK+++LR+I+  M   D+IEFLIDKL  TK N +FF SM +Q
Sbjct: 361 TRSGTRKEELLTTGDELQKMWILRKIIHPMGEIDSIEFLIDKLAATKTNDEFFDSMRRQ 419


>gi|288940346|ref|YP_003442586.1| transcription termination factor Rho [Allochromatium vinosum DSM
           180]
 gi|298286872|sp|P52152|RHO_ALLVD RecName: Full=Transcription termination factor Rho; AltName:
           Full=ATP-dependent helicase Rho
 gi|288895718|gb|ADC61554.1| transcription termination factor Rho [Allochromatium vinosum DSM
           180]
          Length = 418

 Score =  582 bits (1500), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 279/416 (67%), Positives = 345/416 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK      L+A A+S++IE     RKQ+L+F+ILK  + +  +I G+GV+E+L D
Sbjct: 1   MNLTELKKMPVPNLVALAQSMDIEGVGRSRKQDLIFAILKAQAKKGEDIYGDGVLEILSD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS DA+YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P++GERYFALLKVN IN
Sbjct: 61  GFGFLRSADASYLAGPDDIYVSPSQIRRFALRTGDTISGKIRPPKDGERYFALLKVNDIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           FD PE  ++KI F+N TPL+  KR  +E+ N   +DI++R IDL+APIGKGQR LIV+PP
Sbjct: 121 FDRPENAKSKILFENFTPLFAQKRLTLEIGNGSTEDITARTIDLVAPIGKGQRGLIVSPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT++LQNIA SI  NHP+CYLIVLLIDERPEEVT+M RSV+GEVISSTFDE A RHV
Sbjct: 181 KAGKTMMLQNIAQSIGHNHPDCYLIVLLIDERPEEVTEMARSVRGEVISSTFDEPATRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKRDVVILLDSITRLARAYNTVVPSSGKVLTGGVDANALQRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTI+ TALVDTGSRMD+VI+EEFKGTGN EI ++R+IA+KRIFPA++I
Sbjct: 301 FGAARNVEEGGSLTILATALVDTGSRMDDVIYEEFKGTGNMEIHMDRRIAEKRIFPAINI 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSM 419
            +SGTR+E+LL+ + +LQK+++LR+I+  M+   A+EFL DKLK TK N +FF SM
Sbjct: 361 NRSGTRREELLMGQAELQKMWILRKILHPMDELAAMEFLHDKLKATKTNDEFFSSM 416


>gi|77166050|ref|YP_344575.1| transcription termination factor Rho [Nitrosococcus oceani ATCC
           19707]
 gi|254436344|ref|ZP_05049850.1| transcription termination factor Rho [Nitrosococcus oceani AFC27]
 gi|76884364|gb|ABA59045.1| transcription termination factor Rho [Nitrosococcus oceani ATCC
           19707]
 gi|207088034|gb|EDZ65307.1| transcription termination factor Rho [Nitrosococcus oceani AFC27]
          Length = 418

 Score =  582 bits (1500), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 273/418 (65%), Positives = 352/418 (84%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK KS ++LL  A+S+ +E  + +R+Q+L+F++LK  +    +I G GV+E+LQD
Sbjct: 1   MNLTELKTKSASELLDIAQSMGLEGISRLRRQDLIFALLKAHAKNGEDIYGNGVLELLQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS  A+YLAGPDDIYVSPSQI+ F L+TGDTVEG IR P+EGERYFALLKV++IN
Sbjct: 61  GFGFLRSASASYLAGPDDIYVSPSQIRRFGLRTGDTVEGKIRPPKEGERYFALLKVSSIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           F+ PE+ RNK+ F+NLTPL+ ++R  +E  N   +D++ RVIDL+ P+GKGQR LIV+ P
Sbjct: 121 FEPPEQSRNKVLFENLTPLFANERLVLERGNGSTEDLTPRVIDLVVPVGKGQRGLIVSSP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           ++GKT++LQNIA SI  NHPECYLIVLLIDERPEEVT+M RSV+GEV+SSTFDE A+RHV
Sbjct: 181 KSGKTVMLQNIAQSIAANHPECYLIVLLIDERPEEVTEMARSVRGEVVSSTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKRDVVILLDSITRLARAYNTVIPSSGKVLTGGVDANALQRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TAL+DTGSRMD+VI+EEFKGTGN EI LERK+A+KR++PA++I
Sbjct: 301 FGAARNLEEGGSLTIIATALIDTGSRMDDVIYEEFKGTGNMEIHLERKLAEKRVYPAINI 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            +SGTR+E+LL   ++LQK ++L ++++ M+ ++A+EFL+ +LK+TK N +FF SM +
Sbjct: 361 SRSGTRREELLTNPENLQKTWILHKLLAPMDEAEAMEFLLSRLKETKTNDEFFNSMKR 418


>gi|320106039|ref|YP_004181629.1| transcription termination factor Rho [Terriglobus saanensis SP1PR4]
 gi|319924560|gb|ADV81635.1| transcription termination factor Rho [Terriglobus saanensis SP1PR4]
          Length = 416

 Score =  582 bits (1499), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 275/417 (65%), Positives = 349/417 (83%), Gaps = 3/417 (0%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M + ELK KS  +L   A +L+I+  + +RKQ+L+F IL+  S ++  I  EGV+E+L D
Sbjct: 1   MTISELKEKSIAELGKLARALDIQGTSALRKQDLIFKILQAQSEKEGHIFAEGVLEILPD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           G+GFLRSPD NYL GPDDIYVSPSQI+ F LKTGDT+ G++R P EGE+YFAL+K+ AIN
Sbjct: 61  GYGFLRSPDYNYLPGPDDIYVSPSQIRKFDLKTGDTISGNVRPPHEGEKYFALVKIEAIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           F+ PE  RNKI FDNLTPLY ++R  ME      ++IS RV+DL+ P+GKGQR LIVAPP
Sbjct: 121 FESPEETRNKILFDNLTPLYAEERVKMETVR---ENISGRVMDLLTPVGKGQRGLIVAPP 177

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           RTGKT+LLQ+IA+SI  NHPE  LIVLLIDERPEEVTDMQRSV+GEVISSTFDE AARHV
Sbjct: 178 RTGKTMLLQSIANSISTNHPEIVLIVLLIDERPEEVTDMQRSVKGEVISSTFDEPAARHV 237

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++P+SGK+L+GGVD+NALQRPKRF
Sbjct: 238 QVAEMVIEKAKRLVEHKRDVVILLDSITRLARAYNTIVPASGKVLSGGVDSNALQRPKRF 297

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTI+ TALVDTGSRMDEVIFEEFKGTGN E++L+RK+ DKR+FPA+DI
Sbjct: 298 FGAARNIEEGGSLTIMATALVDTGSRMDEVIFEEFKGTGNMEVILDRKLVDKRVFPAIDI 357

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
            +SGTRKE+LL+ ++DLQ++++LR++++ +++ +A+E L D+L +T++N +F ++MN
Sbjct: 358 QRSGTRKEELLIPKEDLQRIWILRKVLNPLSAVEAMELLTDRLGKTRNNTEFLHNMN 414


>gi|163803184|ref|ZP_02197066.1| transcription termination factor Rho [Vibrio sp. AND4]
 gi|159173005|gb|EDP57839.1| transcription termination factor Rho [Vibrio sp. AND4]
          Length = 419

 Score =  582 bits (1499), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 278/419 (66%), Positives = 347/419 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELKN+  + L+   ESL +EN   +RKQ+++F+ILK  +    +I G+GV+E+LQD
Sbjct: 1   MNLTELKNRPVSDLVKLGESLGLENLARLRKQDIIFAILKAHAKGGEDIFGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGD++ G IR P++GERYFALLKVN +N
Sbjct: 61  GFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDSIAGKIRPPKDGERYFALLKVNTVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
            D P+  RNKI F+NLTPL+ ++R  ME  N   +DI++RV+DL +PIGKGQR LIVAPP
Sbjct: 121 DDKPDNARNKILFENLTPLHANERMVMERGNGSTEDITARVLDLASPIGKGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA SI  NHP+C L+VLLIDERPEEVT+MQR V+GEV++STFDE A+RHV
Sbjct: 181 KAGKTMLLQNIAQSIAHNHPDCELMVLLIDERPEEVTEMQRLVKGEVVASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANAL RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVVPSSGKVLTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTI+ TALVDTGS+MDEVI+EEFKGTGN EI L RKIA+KR+FPA+D 
Sbjct: 301 FGAARNVEEGGSLTILATALVDTGSKMDEVIYEEFKGTGNMEIHLNRKIAEKRVFPAIDF 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQ 422
            +SGTR+E+LL + ++LQK+++LR+IV  M  SDA+EFLIDKL  TK N +FF +M +Q
Sbjct: 361 NRSGTRREELLTKNEELQKMWILRKIVHPMGESDAMEFLIDKLAMTKTNNEFFDAMRRQ 419


>gi|37681365|ref|NP_935974.1| transcription termination factor Rho [Vibrio vulnificus YJ016]
 gi|37200117|dbj|BAC95945.1| transcription termination factor [Vibrio vulnificus YJ016]
          Length = 427

 Score =  581 bits (1498), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 279/421 (66%), Positives = 347/421 (82%)

Query: 2   SEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVL 61
           + M L ELKNK  + L+   ESL +EN   +RKQ+++F+ILK  +    +I G+GV+E+L
Sbjct: 7   TTMNLTELKNKPVSDLVKLGESLGLENLARLRKQDIIFAILKAHAKGGEDIFGDGVLEIL 66

Query: 62  QDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNA 121
           QDGFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGD++ G IR P++GERYFALLKVN 
Sbjct: 67  QDGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDSIAGKIRPPKDGERYFALLKVNT 126

Query: 122 INFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVA 181
           +N D P+  RNKI F+NLTPL+ ++R  ME  N   +DI++RV+DL +PIGKGQR LIVA
Sbjct: 127 VNDDRPDNARNKILFENLTPLHANERMVMERGNGSTEDITARVLDLASPIGKGQRGLIVA 186

Query: 182 PPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAAR 241
           PP+ GKT+LLQNIA SI  NHPEC L+VLLIDERPEEVT+MQR V+GEV++STFDE A+R
Sbjct: 187 PPKAGKTMLLQNIAQSITYNHPECVLMVLLIDERPEEVTEMQRLVKGEVVASTFDEPASR 246

Query: 242 HVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPK 301
           HVQVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANAL RPK
Sbjct: 247 HVQVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVVPSSGKVLTGGVDANALHRPK 306

Query: 302 RFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAM 361
           RFFGAARN++EGGSLTII TALVDTGS+MDEVI+EEFKGTGN E+ L RKIA+KR+FPA+
Sbjct: 307 RFFGAARNVEEGGSLTIIATALVDTGSKMDEVIYEEFKGTGNMELHLNRKIAEKRVFPAI 366

Query: 362 DIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
           D  +SGTR+E+LL +  +LQK+++LR+IV  M  +DA+EFLIDKL  TK N +FF +M +
Sbjct: 367 DFNRSGTRREELLTKPDELQKMWILRKIVHPMGETDAMEFLIDKLAMTKTNDEFFDAMRR 426

Query: 422 Q 422
           Q
Sbjct: 427 Q 427


>gi|156972678|ref|YP_001443585.1| transcription termination factor Rho [Vibrio harveyi ATCC BAA-1116]
 gi|156524272|gb|ABU69358.1| hypothetical protein VIBHAR_00336 [Vibrio harveyi ATCC BAA-1116]
          Length = 419

 Score =  581 bits (1498), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 278/419 (66%), Positives = 347/419 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELKN+  + L+   ESL +EN   +RKQ+++F+ILK  +    +I G+GV+E+LQD
Sbjct: 1   MNLTELKNRPVSDLVKLGESLGLENLARLRKQDIIFAILKAHAKGGEDIFGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGD++ G IR P++GERYFALLKVN +N
Sbjct: 61  GFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDSIAGKIRPPKDGERYFALLKVNTVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
            D P+  RNKI F+NLTPL+ ++R  ME  N   +DI++RV+DL +PIGKGQR LIVAPP
Sbjct: 121 DDKPDNARNKILFENLTPLHANERMVMERGNGSTEDITARVLDLASPIGKGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA SI  NHPEC L+VLLIDERPEEVT+MQR V+GEV++STFDE A+RHV
Sbjct: 181 KAGKTMLLQNIAQSIAYNHPECELMVLLIDERPEEVTEMQRLVKGEVVASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANAL RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVVPSSGKVLTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTI+ TALVDTGS+MDEVI+EEFKGTGN EI L RKIA+KR+FPA+D 
Sbjct: 301 FGAARNVEEGGSLTILATALVDTGSKMDEVIYEEFKGTGNMEIHLNRKIAEKRVFPAIDF 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQ 422
            +SGTR+E+LL + ++LQK+++LR+IV  M  +DA+EFLIDKL  TK N +FF +M +Q
Sbjct: 361 NRSGTRREELLTKNEELQKMWILRKIVHPMGETDAMEFLIDKLAMTKTNDEFFDAMRRQ 419


>gi|27364379|ref|NP_759907.1| transcription termination factor Rho [Vibrio vulnificus CMCP6]
 gi|320157762|ref|YP_004190141.1| transcription termination factor Rho [Vibrio vulnificus MO6-24/O]
 gi|27360498|gb|AAO09434.1| transcription termination factor Rho [Vibrio vulnificus CMCP6]
 gi|319933074|gb|ADV87938.1| transcription termination factor Rho [Vibrio vulnificus MO6-24/O]
          Length = 419

 Score =  581 bits (1497), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 279/419 (66%), Positives = 346/419 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELKNK  + L+   ESL +EN   +RKQ+++F+ILK  +    +I G+GV+E+LQD
Sbjct: 1   MNLTELKNKPVSDLVKLGESLGLENLARLRKQDIIFAILKAHAKGGEDIFGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGD++ G IR P++GERYFALLKVN +N
Sbjct: 61  GFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDSIAGKIRPPKDGERYFALLKVNTVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
            D P+  RNKI F+NLTPL+ ++R  ME  N   +DI++RV+DL +PIGKGQR LIVAPP
Sbjct: 121 DDRPDNARNKILFENLTPLHANERMVMERGNGSTEDITARVLDLASPIGKGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA SI  NHPEC L+VLLIDERPEEVT+MQR V+GEV++STFDE A+RHV
Sbjct: 181 KAGKTMLLQNIAQSITYNHPECVLMVLLIDERPEEVTEMQRLVKGEVVASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANAL RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVVPSSGKVLTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TALVDTGS+MDEVI+EEFKGTGN E+ L RKIA+KR+FPA+D 
Sbjct: 301 FGAARNVEEGGSLTIIATALVDTGSKMDEVIYEEFKGTGNMELHLNRKIAEKRVFPAIDF 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQ 422
            +SGTR+E+LL +  +LQK+++LR+IV  M  +DA+EFLIDKL  TK N +FF +M +Q
Sbjct: 361 NRSGTRREELLTKPDELQKMWILRKIVHPMGETDAMEFLIDKLAMTKTNDEFFDAMRRQ 419


>gi|88861238|ref|ZP_01135870.1| transcription termination factor Rho; polarity suppressor
           [Pseudoalteromonas tunicata D2]
 gi|88816719|gb|EAR26542.1| transcription termination factor Rho; polarity suppressor
           [Pseudoalteromonas tunicata D2]
          Length = 419

 Score =  581 bits (1497), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 279/419 (66%), Positives = 346/419 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK+K  ++L+  AES+ +EN   +RKQ+++F+ILK  S     I G GV+E+LQD
Sbjct: 1   MHLSELKHKPISELVQLAESMGLENVARLRKQDIIFAILKAHSKSGENIFGLGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS +A+YLAGPDDIYVSPSQI+ FSL+TGD++ G IR P+EGERYFALLKVN +N
Sbjct: 61  GFGFLRSSEASYLAGPDDIYVSPSQIRRFSLRTGDSISGLIRPPKEGERYFALLKVNEVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           FD PE  RNKI F+NLTPL+ ++R  ME  N   +DI++RV+DL +PIGKGQR LIVAPP
Sbjct: 121 FDRPESSRNKILFENLTPLHANERLRMERGNGSTEDITARVLDLASPIGKGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA SI  NHPEC L+VLLIDERPEEVT+MQR V+GEVI+STFDE A+RHV
Sbjct: 181 KAGKTMLLQNIAQSITHNHPECELMVLLIDERPEEVTEMQRLVKGEVIASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DV+ILLDSITRL RAYN ++PSSGK+LTGGVDANAL +PKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVIILLDSITRLARAYNTVIPSSGKVLTGGVDANALHKPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TAL+DTGS+MDEVI+EEFKGTGN E+ L RKIA+KR+FPA+D 
Sbjct: 301 FGAARNVEEGGSLTIIATALIDTGSKMDEVIYEEFKGTGNMELHLNRKIAEKRVFPAIDF 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQ 422
            +SGTR+E+LL +  ++QK+++LR+IV  M   DA+EFLIDKL  +K N +FF SM ++
Sbjct: 361 NRSGTRREELLTKPDEIQKMWILRKIVHDMPEIDAMEFLIDKLAMSKTNDEFFDSMKRK 419


>gi|148978450|ref|ZP_01814924.1| transcription termination factor Rho [Vibrionales bacterium SWAT-3]
 gi|145962357|gb|EDK27637.1| transcription termination factor Rho [Vibrionales bacterium SWAT-3]
          Length = 419

 Score =  581 bits (1497), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 277/419 (66%), Positives = 346/419 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELKN+  ++L+   ESL +EN   +RKQ+++F+ILK  +    +I G+GV+E+LQD
Sbjct: 1   MNLTELKNRPVSELVKLGESLGLENLARLRKQDIIFAILKAHAKSGEDIFGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGD++ G IR P++GERYFALLKVN +N
Sbjct: 61  GFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDSIAGKIRPPKDGERYFALLKVNTVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
            D P+  RNKI F+NLTPL+ ++R  ME  N   +DI++R++DL +PIGKGQR LIVAPP
Sbjct: 121 HDKPDNARNKILFENLTPLHANERMVMERGNGATEDITARILDLASPIGKGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA SI  NHPEC L+VLLIDERPEEVT+MQR V+GEV++STFDE A+RHV
Sbjct: 181 KAGKTMLLQNIAQSIAHNHPECELMVLLIDERPEEVTEMQRLVKGEVVASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANAL RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVVPSSGKVLTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TALVDTGS+MDEVI+EEFKGTGN E+ L RKIA+KR+FPA+D 
Sbjct: 301 FGAARNVEEGGSLTIIATALVDTGSKMDEVIYEEFKGTGNMELHLNRKIAEKRVFPAIDF 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQ 422
            +SGTR+E+LL +  +LQK+++LR+IV  M   DA+EFLIDKL  TK N +FF +M +Q
Sbjct: 361 NRSGTRREELLTKNDELQKMWILRKIVHPMGEIDAMEFLIDKLAMTKTNDEFFDAMRRQ 419


>gi|49363|emb|CAA79852.1| Rho Factor [Salmonella enterica subsp. enterica serovar
           Typhimurium]
          Length = 419

 Score =  580 bits (1496), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 274/418 (65%), Positives = 344/418 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELKN   ++L+   ES+ +EN   MRKQ+++F+ILK  +    +I G+GV+E+LQD
Sbjct: 1   MNLTELKNTPVSELITLGESMGLENLARMRKQDIIFAILKQHAKSGEDIFGDGVVEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P+EGERYFALLKVN +N
Sbjct: 61  GFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNEVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           +D PE  RNKI F+NLTPL+ + R  ME  N   +D+++RV+DL +PIG+GQR LIVAPP
Sbjct: 121 YDKPENARNKILFENLTPLHANSRLRMERGNGSTEDLTARVLDLASPIGRGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA SI  NHP+C L+VLLIDERPEEVT+MQR V+GEV++STFDE A+RHV
Sbjct: 181 KAGKTMLLQNIAQSIAYNHPDCVLMVLLIDERPEEVTEMQRLVKGEVVASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DV+ILLDSITRL RAYN ++P+SGK+LTGGVDANAL RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVIILLDSITRLARAYNTVVPASGKVLTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TAL+DTGS+MDEVI+EEFKGTGN E+ L RKIA+KR+FPA+D 
Sbjct: 301 FGAARNVEEGGSLTIIATALIDTGSKMDEVIYEEFKGTGNMELHLSRKIAEKRVFPAIDY 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            +SGTRKE+LL  +++LQK+++LR+I+  M   DA+EFLI+KL  TK N DFF  M +
Sbjct: 361 NRSGTRKEELLTTQEELQKMWILRKIIHPMGEIDAMEFLINKLAMTKTNDDFFEMMKR 418


>gi|262273617|ref|ZP_06051431.1| transcription termination factor Rho [Grimontia hollisae CIP
           101886]
 gi|262222595|gb|EEY73906.1| transcription termination factor Rho [Grimontia hollisae CIP
           101886]
          Length = 421

 Score =  580 bits (1496), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 277/419 (66%), Positives = 346/419 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELKN++ ++L+A  ES+ +EN   +RKQ+++F+ILK  +    +I G GV+E+LQD
Sbjct: 1   MNLTELKNQAVSELVALGESMGLENLARLRKQDIIFAILKQHAKSGEDIFGNGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P++GERYFALLKVN +N
Sbjct: 61  GFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKDGERYFALLKVNEVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
            D P+  RNKI F+NLTPL+ ++R  ME  N   +DI++RV+DL +PIGKGQR LIVAPP
Sbjct: 121 HDKPDNARNKILFENLTPLHANERMVMERGNGSTEDITARVLDLASPIGKGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA SI  NHPEC L+VLLIDERPEEVT+MQR V+GEV++STFDE A+RHV
Sbjct: 181 KAGKTMLLQNIAQSIAYNHPECELMVLLIDERPEEVTEMQRLVKGEVVASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANAL RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVVPSSGKVLTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TALVDTGS+MDEVI+EEFKGTGN E+ L RKIA+KR+FPA+D 
Sbjct: 301 FGAARNVEEGGSLTIIATALVDTGSKMDEVIYEEFKGTGNMELHLSRKIAEKRVFPAIDF 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQ 422
            +SGTR+E+LL +  +LQK+++LR+IV  M   + +EFLIDKL  TK N +FF +M +Q
Sbjct: 361 TRSGTRREELLTKPDELQKMWILRKIVHPMGEIEGMEFLIDKLAMTKTNDEFFDAMRRQ 419


>gi|332994628|gb|AEF04683.1| transcription termination factor Rho [Alteromonas sp. SN2]
          Length = 421

 Score =  580 bits (1495), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 276/419 (65%), Positives = 345/419 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELKNK  ++L+A +E + +EN    RKQ+++FSILK  +    +I G+GV+E+LQD
Sbjct: 1   MNLTELKNKPISELVAMSEEMGLENMARARKQDIIFSILKSHAKGGEDIFGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P++ ERYFALLK+  +N
Sbjct: 61  GFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTIAGKIRPPKDSERYFALLKIREVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           FD PE  RNKI F+NLTPL+ + R  ME  N   +DI++RV+DL +PIG+GQR LIVAPP
Sbjct: 121 FDKPENSRNKILFENLTPLHANDRLRMERGNGSTEDITARVLDLASPIGRGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA SI  NHPEC L+VLLIDERPEEVT+M R VQGEV++STFDE A+RHV
Sbjct: 181 KAGKTLLLQNIAQSIAANHPECELMVLLIDERPEEVTEMHRLVQGEVVASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANAL +PKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVIPSSGKVLTGGVDANALHKPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TAL+DTGS+MDEVI+EEFKGTGN E+ L RKIA+KR+FPA+D 
Sbjct: 301 FGAARNVEEGGSLTIIATALIDTGSKMDEVIYEEFKGTGNMELHLNRKIAEKRVFPAIDF 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQ 422
            +SGTR+E+LL  +++LQK+++LR+IV  M+  DAIEFLI+KL  TK N +FF +M +Q
Sbjct: 361 NRSGTRREELLTSQEELQKMWILRKIVHEMSEIDAIEFLINKLAMTKTNDEFFNAMKRQ 419


>gi|16762213|ref|NP_457830.1| transcription termination factor Rho [Salmonella enterica subsp.
           enterica serovar Typhi str. CT18]
 gi|16767192|ref|NP_462807.1| transcription termination factor Rho [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|29143702|ref|NP_807044.1| transcription termination factor Rho [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
 gi|56415776|ref|YP_152851.1| transcription termination factor Rho [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|161505566|ref|YP_001572678.1| transcription termination factor Rho [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|161617034|ref|YP_001590999.1| transcription termination factor Rho [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|167553314|ref|ZP_02347064.1| transcription termination factor Rho [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
 gi|167994612|ref|ZP_02575703.1| transcription termination factor Rho [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|168234237|ref|ZP_02659295.1| transcription termination factor Rho [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
 gi|168238373|ref|ZP_02663431.1| transcription termination factor Rho [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
 gi|168244968|ref|ZP_02669900.1| transcription termination factor Rho [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|168263192|ref|ZP_02685165.1| transcription termination factor Rho [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
 gi|168467667|ref|ZP_02701504.1| transcription termination factor Rho [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|168822971|ref|ZP_02834971.1| transcription termination factor Rho [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|194444899|ref|YP_002043154.1| transcription termination factor Rho [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194450354|ref|YP_002047937.1| transcription termination factor Rho [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|194469338|ref|ZP_03075322.1| transcription termination factor Rho [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|194736430|ref|YP_002116852.1| transcription termination factor Rho [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|197249760|ref|YP_002148846.1| transcription termination factor Rho [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|197264201|ref|ZP_03164275.1| transcription termination factor Rho [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|197364706|ref|YP_002144343.1| transcription termination factor Rho [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
 gi|198243711|ref|YP_002217854.1| transcription termination factor Rho [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|200388193|ref|ZP_03214805.1| transcription termination factor Rho [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
 gi|204930193|ref|ZP_03221170.1| transcription termination factor Rho [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
 gi|205354513|ref|YP_002228314.1| transcription termination factor Rho [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 287/91]
 gi|207859128|ref|YP_002245779.1| transcription termination factor Rho [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|213021585|ref|ZP_03336032.1| transcription termination factor Rho [Salmonella enterica subsp.
           enterica serovar Typhi str. 404ty]
 gi|213051687|ref|ZP_03344565.1| transcription termination factor Rho [Salmonella enterica subsp.
           enterica serovar Typhi str. E00-7866]
 gi|213426567|ref|ZP_03359317.1| transcription termination factor Rho [Salmonella enterica subsp.
           enterica serovar Typhi str. E02-1180]
 gi|213648369|ref|ZP_03378422.1| transcription termination factor Rho [Salmonella enterica subsp.
           enterica serovar Typhi str. J185]
 gi|213856932|ref|ZP_03384172.1| transcription termination factor Rho [Salmonella enterica subsp.
           enterica serovar Typhi str. M223]
 gi|224585739|ref|YP_002639538.1| transcription termination factor Rho [Salmonella enterica subsp.
           enterica serovar Paratyphi C strain RKS4594]
 gi|238912926|ref|ZP_04656763.1| transcription termination factor Rho [Salmonella enterica subsp.
           enterica serovar Tennessee str. CDC07-0191]
 gi|289825738|ref|ZP_06544906.1| transcription termination factor Rho [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-3139]
 gi|61230321|sp|P0A295|RHO_SALTY RecName: Full=Transcription termination factor Rho; AltName:
           Full=ATP-dependent helicase Rho
 gi|61230322|sp|P0A296|RHO_SALTI RecName: Full=Transcription termination factor Rho; AltName:
           Full=ATP-dependent helicase Rho
 gi|25299648|pir||AE0922 transcription termination factor STY3638 [imported] - Salmonella
           enterica subsp. enterica serovar Typhi (strain CT18)
 gi|6960280|gb|AAF33470.1| S. typhimurium transcription termination factor (RHO) (SP:P26980)
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. LT2]
 gi|16422485|gb|AAL22766.1| transcription termination factor Rho [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|16504517|emb|CAD09399.1| transcription termination factor [Salmonella enterica subsp.
           enterica serovar Typhi]
 gi|29139337|gb|AAO70904.1| transcription termination factor [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
 gi|56130033|gb|AAV79539.1| transcription termination factor [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|160866913|gb|ABX23536.1| hypothetical protein SARI_03736 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
 gi|161366398|gb|ABX70166.1| hypothetical protein SPAB_04862 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194403562|gb|ACF63784.1| transcription termination factor Rho [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194408658|gb|ACF68877.1| transcription termination factor Rho [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|194455702|gb|EDX44541.1| transcription termination factor Rho [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|194711932|gb|ACF91153.1| transcription termination factor Rho [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|195630005|gb|EDX48665.1| transcription termination factor Rho [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|197096183|emb|CAR61779.1| transcription termination factor [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
 gi|197213463|gb|ACH50860.1| transcription termination factor Rho [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|197242456|gb|EDY25076.1| transcription termination factor Rho [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|197288790|gb|EDY28165.1| transcription termination factor Rho [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
 gi|197938227|gb|ACH75560.1| transcription termination factor Rho [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|199605291|gb|EDZ03836.1| transcription termination factor Rho [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
 gi|204320597|gb|EDZ05799.1| transcription termination factor Rho [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
 gi|205274294|emb|CAR39315.1| transcription termination factor [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 287/91]
 gi|205322225|gb|EDZ10064.1| transcription termination factor Rho [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
 gi|205327557|gb|EDZ14321.1| transcription termination factor Rho [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|205331810|gb|EDZ18574.1| transcription termination factor Rho [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
 gi|205336257|gb|EDZ23021.1| transcription termination factor Rho [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|205340701|gb|EDZ27465.1| transcription termination factor Rho [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|205348063|gb|EDZ34694.1| transcription termination factor Rho [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
 gi|206710931|emb|CAR35297.1| transcription termination factor [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|224470267|gb|ACN48097.1| transcription termination factor Rho [Salmonella enterica subsp.
           enterica serovar Paratyphi C strain RKS4594]
 gi|261249045|emb|CBG26905.1| transcription termination factor [Salmonella enterica subsp.
           enterica serovar Typhimurium str. D23580]
 gi|267996198|gb|ACY91083.1| transcription termination factor Rho [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 14028S]
 gi|301160437|emb|CBW19966.1| transcription termination factor [Salmonella enterica subsp.
           enterica serovar Typhimurium str. SL1344]
 gi|312915040|dbj|BAJ39014.1| transcription termination factor Rho [Salmonella enterica subsp.
           enterica serovar Typhimurium str. T000240]
 gi|321225442|gb|EFX50499.1| Transcription termination factor Rho [Salmonella enterica subsp.
           enterica serovar Typhimurium str. TN061786]
 gi|322613000|gb|EFY09951.1| transcription termination factor Rho [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315996572]
 gi|322617412|gb|EFY14312.1| transcription termination factor Rho [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-1]
 gi|322625596|gb|EFY22418.1| transcription termination factor Rho [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-3]
 gi|322627019|gb|EFY23812.1| transcription termination factor Rho [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-4]
 gi|322631265|gb|EFY28028.1| transcription termination factor Rho [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-1]
 gi|322638298|gb|EFY34997.1| transcription termination factor Rho [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-2]
 gi|322642852|gb|EFY39438.1| transcription termination factor Rho [Salmonella enterica subsp.
           enterica serovar Montevideo str. 531954]
 gi|322646992|gb|EFY43494.1| transcription termination factor Rho [Salmonella enterica subsp.
           enterica serovar Montevideo str. NC_MB110209-0054]
 gi|322650380|gb|EFY46793.1| transcription termination factor Rho [Salmonella enterica subsp.
           enterica serovar Montevideo str. OH_2009072675]
 gi|322656330|gb|EFY52624.1| transcription termination factor Rho [Salmonella enterica subsp.
           enterica serovar Montevideo str. CASC_09SCPH15965]
 gi|322657555|gb|EFY53825.1| transcription termination factor Rho [Salmonella enterica subsp.
           enterica serovar Montevideo str. 19N]
 gi|322665966|gb|EFY62147.1| transcription termination factor Rho [Salmonella enterica subsp.
           enterica serovar Montevideo str. 81038-01]
 gi|322666705|gb|EFY62882.1| transcription termination factor Rho [Salmonella enterica subsp.
           enterica serovar Montevideo str. MD_MDA09249507]
 gi|322671052|gb|EFY67182.1| transcription termination factor Rho [Salmonella enterica subsp.
           enterica serovar Montevideo str. 414877]
 gi|322679241|gb|EFY75293.1| transcription termination factor Rho [Salmonella enterica subsp.
           enterica serovar Montevideo str. 366867]
 gi|322681645|gb|EFY77672.1| transcription termination factor Rho [Salmonella enterica subsp.
           enterica serovar Montevideo str. 413180]
 gi|322686028|gb|EFY82016.1| transcription termination factor Rho [Salmonella enterica subsp.
           enterica serovar Montevideo str. 446600]
 gi|323192654|gb|EFZ77882.1| transcription termination factor Rho [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609458-1]
 gi|323197839|gb|EFZ82970.1| transcription termination factor Rho [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556150-1]
 gi|323203728|gb|EFZ88749.1| transcription termination factor Rho [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609460]
 gi|323205397|gb|EFZ90371.1| transcription termination factor Rho [Salmonella enterica subsp.
           enterica serovar Montevideo str. 507440-20]
 gi|323210768|gb|EFZ95644.1| transcription termination factor Rho [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556152]
 gi|323215934|gb|EGA00667.1| transcription termination factor Rho [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB101509-0077]
 gi|323221427|gb|EGA05845.1| transcription termination factor Rho [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB102109-0047]
 gi|323227327|gb|EGA11494.1| transcription termination factor Rho [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB110209-0055]
 gi|323231740|gb|EGA15851.1| transcription termination factor Rho [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB111609-0052]
 gi|323236155|gb|EGA20232.1| transcription termination factor Rho [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009083312]
 gi|323239608|gb|EGA23656.1| transcription termination factor Rho [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009085258]
 gi|323244296|gb|EGA28304.1| transcription termination factor Rho [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315731156]
 gi|323249607|gb|EGA33519.1| transcription termination factor Rho [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2009159199]
 gi|323250301|gb|EGA34187.1| transcription termination factor Rho [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008282]
 gi|323256508|gb|EGA40239.1| transcription termination factor Rho [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008283]
 gi|323259794|gb|EGA43427.1| transcription termination factor Rho [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008284]
 gi|323265202|gb|EGA48700.1| transcription termination factor Rho [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008285]
 gi|323268369|gb|EGA51841.1| transcription termination factor Rho [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008287]
 gi|326625640|gb|EGE31985.1| transcription termination factor Rho [Salmonella enterica subsp.
           enterica serovar Dublin str. 3246]
 gi|332990757|gb|AEF09740.1| transcription termination factor Rho [Salmonella enterica subsp.
           enterica serovar Typhimurium str. UK-1]
          Length = 419

 Score =  580 bits (1495), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 274/418 (65%), Positives = 344/418 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELKN   ++L+   ES+ +EN   MRKQ+++F+ILK  +    +I G+GV+E+LQD
Sbjct: 1   MNLTELKNTPVSELITLGESMGLENLARMRKQDIIFAILKQHAKSGEDIFGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P+EGERYFALLKVN +N
Sbjct: 61  GFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNEVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           +D PE  RNKI F+NLTPL+ + R  ME  N   +D+++RV+DL +PIG+GQR LIVAPP
Sbjct: 121 YDKPENARNKILFENLTPLHANSRLRMERGNGSTEDLTARVLDLASPIGRGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA SI  NHP+C L+VLLIDERPEEVT+MQR V+GEV++STFDE A+RHV
Sbjct: 181 KAGKTMLLQNIAQSIAYNHPDCVLMVLLIDERPEEVTEMQRLVKGEVVASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DV+ILLDSITRL RAYN ++P+SGK+LTGGVDANAL RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVIILLDSITRLARAYNTVVPASGKVLTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TAL+DTGS+MDEVI+EEFKGTGN E+ L RKIA+KR+FPA+D 
Sbjct: 301 FGAARNVEEGGSLTIIATALIDTGSKMDEVIYEEFKGTGNMELHLSRKIAEKRVFPAIDY 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            +SGTRKE+LL  +++LQK+++LR+I+  M   DA+EFLI+KL  TK N DFF  M +
Sbjct: 361 NRSGTRKEELLTTQEELQKMWILRKIIHPMGEIDAMEFLINKLAMTKTNDDFFEMMKR 418


>gi|88812431|ref|ZP_01127680.1| transcription termination factor Rho [Nitrococcus mobilis Nb-231]
 gi|88790217|gb|EAR21335.1| transcription termination factor Rho [Nitrococcus mobilis Nb-231]
          Length = 418

 Score =  580 bits (1495), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 275/418 (65%), Positives = 348/418 (83%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK K  T+L+  A+SL IE     RKQ+++FSILK  + +  +I G+GV+E+LQD
Sbjct: 1   MNLTELKQKPATELVEIAQSLGIEGMARSRKQDVIFSILKAQAKKGEDIWGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++Y+AGPDDIYVSPSQI+ FSL+TGDTV G IR P+EGERYFALLKVN IN
Sbjct: 61  GFGFLRSADSSYMAGPDDIYVSPSQIRRFSLRTGDTVAGKIRPPKEGERYFALLKVNEIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           F+ PE  R+K+ F+NLTPL+   R  ME  N   +D+++R+IDL+APIGKGQR L+V+PP
Sbjct: 121 FEKPEAARHKVLFENLTPLFAKSRLKMERGNGSTEDLTARIIDLVAPIGKGQRGLVVSPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT++LQNIA SI  N+PECY+IVLLIDERPEEVT+MQRSV+GEV+SSTFDE A+RHV
Sbjct: 181 KAGKTMMLQNIAQSITSNYPECYVIVLLIDERPEEVTEMQRSVRGEVVSSTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANAL RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKQDVVILLDSITRLARAYNTVVPSSGKVLTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TALV+TGSRMD+VI+EEFKGTGN E+ L+R+I++KRI+P+++I
Sbjct: 301 FGAARNVEEGGSLTIIATALVETGSRMDDVIYEEFKGTGNMELHLDRRISEKRIYPSINI 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            +SGTR+E+LL+   +LQK ++LR+++  M+   AIEFL+DKLK TK N++FF  M +
Sbjct: 361 NRSGTRREELLMGPDELQKAWILRKLLHPMDELAAIEFLLDKLKDTKTNQEFFEYMKR 418


>gi|269103750|ref|ZP_06156447.1| transcription termination factor Rho [Photobacterium damselae
           subsp. damselae CIP 102761]
 gi|268163648|gb|EEZ42144.1| transcription termination factor Rho [Photobacterium damselae
           subsp. damselae CIP 102761]
          Length = 419

 Score =  580 bits (1495), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 278/419 (66%), Positives = 345/419 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK +  + L+A  ESL +EN   +RKQ+++FSILK  +    +I G+GV+E+LQD
Sbjct: 1   MNLTELKKQPISNLVALGESLGLENLARLRKQDIIFSILKQHAKSGEDIFGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P++GERYFALLKVN +N
Sbjct: 61  GFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKDGERYFALLKVNEVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           +D P+  RNKI F+NLTPL+ ++R  ME  N   +DI++RV+DL +PIGKGQR LIVAPP
Sbjct: 121 YDKPDNARNKILFENLTPLHANERMRMERGNGSTEDITARVLDLASPIGKGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA SI  NHPEC L+VLLIDERPEEVT+MQR V+GEV++STFDE A+RHV
Sbjct: 181 KAGKTMLLQNIAQSIAHNHPECELMVLLIDERPEEVTEMQRLVKGEVVASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANAL RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVVPSSGKVLTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TALVDTGS+MDEVI+EEFKGTGN E+ L RKIA+KR+FPA+D 
Sbjct: 301 FGAARNVEEGGSLTIIATALVDTGSKMDEVIYEEFKGTGNMELHLSRKIAEKRVFPAIDF 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQ 422
            +SGTR+E+LL +  +LQK+++LR+IV  M   D++EFLI KL  TK N +FF +M +Q
Sbjct: 361 NRSGTRREELLAKADELQKMWILRKIVHPMGEIDSMEFLIGKLSMTKTNDEFFDAMRRQ 419


>gi|326796692|ref|YP_004314512.1| transcription termination factor Rho [Marinomonas mediterranea
           MMB-1]
 gi|326547456|gb|ADZ92676.1| transcription termination factor Rho [Marinomonas mediterranea
           MMB-1]
          Length = 421

 Score =  580 bits (1495), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 277/420 (65%), Positives = 350/420 (83%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK KS  +LL  A  + ++N    RKQ+++FSILK  +    +I G+G++E+LQD
Sbjct: 1   MNLTELKQKSVPELLDIAAEMGLDNLARSRKQDVIFSILKRHAKSGEDIYGDGILEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSPD++YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P++GERYFALLKVN IN
Sbjct: 61  GFGFLRSPDSSYLAGPDDIYVSPSQIRRFNLRTGDTIAGKIRPPKDGERYFALLKVNEIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           FD P+ VRNKI F+NLTPL+ D R  ME  N   +D++SR+IDL+AP+GKGQR+L+V+PP
Sbjct: 121 FDKPDSVRNKILFENLTPLFADDRLLMEAGNGSTEDVTSRIIDLVAPMGKGQRALVVSPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT +LQNIA++I +N+PEC++IVLLIDERPEEVT+M R+V+GEV++STFDE  ARHV
Sbjct: 181 KAGKTFMLQNIANAITRNNPECHMIVLLIDERPEEVTEMSRTVRGEVVASTFDEPPARHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANAL+RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVIPSSGKVLTGGVDANALERPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TALVDTGS+MDEVIFEEFKGTGNSE+ L+RKIA+KR FPA++I
Sbjct: 301 FGAARNIEEGGSLTIIATALVDTGSKMDEVIFEEFKGTGNSELHLDRKIAEKRTFPAINI 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQN 423
            +SGTR+EDLL    +LQ++++LR++++ M    A EFLID+LK T  N++FF SM  +N
Sbjct: 361 RRSGTRREDLLTTEDELQRMWILRKLLNPMEDIAATEFLIDRLKVTNTNEEFFQSMKGKN 420


>gi|62182392|ref|YP_218809.1| transcription termination factor Rho [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|62130025|gb|AAX67728.1| transcription termination factor Rho; polarity suppressor
           [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|320088333|emb|CBY98093.1| Transcription termination factor rho ATP-dependent helicase rho
           [Salmonella enterica subsp. enterica serovar Weltevreden
           str. 2007-60-3289-1]
 gi|322716885|gb|EFZ08456.1| transcription termination factor Rho [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. A50]
 gi|323132269|gb|ADX19699.1| transcription termination factor Rho [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 4/74]
 gi|326629648|gb|EGE35991.1| transcription termination factor Rho [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 9]
          Length = 443

 Score =  580 bits (1495), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 274/418 (65%), Positives = 344/418 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELKN   ++L+   ES+ +EN   MRKQ+++F+ILK  +    +I G+GV+E+LQD
Sbjct: 25  MNLTELKNTPVSELITLGESMGLENLARMRKQDIIFAILKQHAKSGEDIFGDGVLEILQD 84

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P+EGERYFALLKVN +N
Sbjct: 85  GFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNEVN 144

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           +D PE  RNKI F+NLTPL+ + R  ME  N   +D+++RV+DL +PIG+GQR LIVAPP
Sbjct: 145 YDKPENARNKILFENLTPLHANSRLRMERGNGSTEDLTARVLDLASPIGRGQRGLIVAPP 204

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA SI  NHP+C L+VLLIDERPEEVT+MQR V+GEV++STFDE A+RHV
Sbjct: 205 KAGKTMLLQNIAQSIAYNHPDCVLMVLLIDERPEEVTEMQRLVKGEVVASTFDEPASRHV 264

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DV+ILLDSITRL RAYN ++P+SGK+LTGGVDANAL RPKRF
Sbjct: 265 QVAEMVIEKAKRLVEHKKDVIILLDSITRLARAYNTVVPASGKVLTGGVDANALHRPKRF 324

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TAL+DTGS+MDEVI+EEFKGTGN E+ L RKIA+KR+FPA+D 
Sbjct: 325 FGAARNVEEGGSLTIIATALIDTGSKMDEVIYEEFKGTGNMELHLSRKIAEKRVFPAIDY 384

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            +SGTRKE+LL  +++LQK+++LR+I+  M   DA+EFLI+KL  TK N DFF  M +
Sbjct: 385 NRSGTRKEELLTTQEELQKMWILRKIIHPMGEIDAMEFLINKLAMTKTNDDFFEMMKR 442


>gi|229524735|ref|ZP_04414140.1| transcription termination factor Rho [Vibrio cholerae bv. albensis
           VL426]
 gi|229338316|gb|EEO03333.1| transcription termination factor Rho [Vibrio cholerae bv. albensis
           VL426]
          Length = 419

 Score =  580 bits (1494), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 278/419 (66%), Positives = 344/419 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELKN   + L+   ESL +EN   +RKQ+++F+ILK  +    +I G+GV+E+LQD
Sbjct: 1   MNLTELKNTPVSDLVKLGESLGLENLARLRKQDIIFAILKAHAKSGEDIFGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGD++ G IR P+EGERYFALLKVN +N
Sbjct: 61  GFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDSIAGKIRPPKEGERYFALLKVNTVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
            D P+  RNKI F+NLTPL+ ++R  ME  N   +DI++RV+DL APIGKGQR LIVAPP
Sbjct: 121 DDRPDNARNKILFENLTPLHANERMVMERGNGSTEDITARVLDLAAPIGKGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA SI  NHPEC  +VLLIDERPEEVT+MQR V+GEV++STFDE A+RHV
Sbjct: 181 KAGKTMLLQNIAQSIASNHPECVRMVLLIDERPEEVTEMQRLVKGEVVASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++P+SGK+LTGGVDANAL RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVVPASGKVLTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TALVDTGS+MDEVI+EEFKGTGN E+ L RKIA+KR+FPA+D 
Sbjct: 301 FGAARNVEEGGSLTIIATALVDTGSKMDEVIYEEFKGTGNMELHLNRKIAEKRVFPAIDF 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQ 422
            +SGTR+E+LL +  +LQK+++LR+IV  M  +DA+EFLIDKL  TK N +FF +M +Q
Sbjct: 361 NRSGTRREELLTKTDELQKMWILRKIVHPMGETDAMEFLIDKLAMTKTNDEFFDAMRRQ 419


>gi|53802749|ref|YP_112596.1| transcription termination factor Rho [Methylococcus capsulatus str.
           Bath]
 gi|53756510|gb|AAU90801.1| transcription termination factor Rho [Methylococcus capsulatus str.
           Bath]
          Length = 418

 Score =  580 bits (1494), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 278/418 (66%), Positives = 350/418 (83%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L +LK K  ++L+  AESL+IE     RKQ+L+FSILK L+    +I G+GV+E+LQD
Sbjct: 1   MNLTDLKRKPVSELIEIAESLDIEGVARTRKQDLIFSILKKLAKSGEDIYGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSPD+++LAGPDDIYVSPSQI+ FSL+TGDT+ G IR P++ ERYFA+LKV  IN
Sbjct: 61  GFGFLRSPDSSFLAGPDDIYVSPSQIRRFSLRTGDTISGKIRPPKDSERYFAMLKVEQIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           ++ PE  ++KI F NLTPL+P +RF +EL N   +D+++RVIDL+APIGKGQR LIV+PP
Sbjct: 121 YEPPENAKHKILFSNLTPLFPVQRFVLELGNGTTEDLTARVIDLVAPIGKGQRGLIVSPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT++LQN+AHSI + +PECYLIVLLIDERPEEVT+MQRSV+GEV+SSTFDE  ARHV
Sbjct: 181 KAGKTMMLQNVAHSIAEKNPECYLIVLLIDERPEEVTEMQRSVKGEVVSSTFDEPPARHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANAL+RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKRDVVILLDSITRLARAYNTVVPSSGKVLTGGVDANALERPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TAL+DTGSRMDEVI+EEFKGTGN E+ LERKIA++RI+PA++I
Sbjct: 301 FGAARNIEEGGSLTIIATALIDTGSRMDEVIYEEFKGTGNMELHLERKIAERRIYPAINI 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            +SGTR+E+ LV+  +LQK ++LR+I+  M+   A EFL+ KLK +K N++FF  M +
Sbjct: 361 NRSGTRREEYLVDPDELQKSWILRKILQPMDEMAANEFLLGKLKDSKTNREFFDMMKR 418


>gi|26250521|ref|NP_756561.1| transcription termination factor Rho [Escherichia coli CFT073]
 gi|91213304|ref|YP_543290.1| transcription termination factor Rho [Escherichia coli UTI89]
 gi|110644109|ref|YP_671839.1| transcription termination factor Rho [Escherichia coli 536]
 gi|110807528|ref|YP_691048.1| transcription termination factor Rho [Shigella flexneri 5 str.
           8401]
 gi|117626043|ref|YP_859366.1| transcription termination factor Rho [Escherichia coli APEC O1]
 gi|237702792|ref|ZP_04533273.1| transcription termination factor rho [Escherichia sp. 3_2_53FAA]
 gi|254038994|ref|ZP_04873045.1| transcription termination factor rho [Escherichia sp. 1_1_43]
 gi|331644516|ref|ZP_08345636.1| transcription termination factor Rho [Escherichia coli H736]
 gi|331649607|ref|ZP_08350689.1| transcription termination factor Rho [Escherichia coli M605]
 gi|331655466|ref|ZP_08356459.1| transcription termination factor Rho [Escherichia coli M718]
 gi|331675252|ref|ZP_08376003.1| transcription termination factor Rho [Escherichia coli TA280]
 gi|331679891|ref|ZP_08380554.1| transcription termination factor Rho [Escherichia coli H591]
 gi|332282710|ref|ZP_08395123.1| transcription termination factor rho [Shigella sp. D9]
 gi|26110951|gb|AAN83135.1|AE016769_250 Transcription termination factor rho [Escherichia coli CFT073]
 gi|91074878|gb|ABE09759.1| transcription termination factor rho [Escherichia coli UTI89]
 gi|110345701|gb|ABG71938.1| transcription termination factor rho [Escherichia coli 536]
 gi|110617076|gb|ABF05743.1| transcription termination factor Rho [Shigella flexneri 5 str.
           8401]
 gi|115515167|gb|ABJ03242.1| transcription termination factor Rho [Escherichia coli APEC O1]
 gi|226838685|gb|EEH70713.1| transcription termination factor rho [Escherichia sp. 1_1_43]
 gi|226902963|gb|EEH89222.1| transcription termination factor rho [Escherichia sp. 3_2_53FAA]
 gi|281180832|dbj|BAI57162.1| transcription termination factor Rho [Escherichia coli SE15]
 gi|281603172|gb|ADA76156.1| Transcription termination factor rho [Shigella flexneri 2002017]
 gi|307555910|gb|ADN48685.1| transcription termination factor Rho [Escherichia coli ABU 83972]
 gi|312948338|gb|ADR29165.1| transcription termination factor Rho [Escherichia coli O83:H1 str.
           NRG 857C]
 gi|331036188|gb|EGI08423.1| transcription termination factor Rho [Escherichia coli H736]
 gi|331041477|gb|EGI13625.1| transcription termination factor Rho [Escherichia coli M605]
 gi|331046787|gb|EGI18871.1| transcription termination factor Rho [Escherichia coli M718]
 gi|331067538|gb|EGI38942.1| transcription termination factor Rho [Escherichia coli TA280]
 gi|331072438|gb|EGI43770.1| transcription termination factor Rho [Escherichia coli H591]
 gi|332105062|gb|EGJ08408.1| transcription termination factor rho [Shigella sp. D9]
          Length = 443

 Score =  580 bits (1494), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 274/420 (65%), Positives = 345/420 (82%)

Query: 2   SEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVL 61
           + M L ELKN   ++L+   E++ +EN   MRKQ+++F+ILK  +    +I G+GV+E+L
Sbjct: 23  TTMNLTELKNTPVSELITLGENMGLENLARMRKQDIIFAILKQHAKSGEDIFGDGVLEIL 82

Query: 62  QDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNA 121
           QDGFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P+EGERYFALLKVN 
Sbjct: 83  QDGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNE 142

Query: 122 INFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVA 181
           +NFD PE  RNKI F+NLTPL+ + R  ME  N   +D+++RV+DL +PIG+GQR LIVA
Sbjct: 143 VNFDKPENARNKILFENLTPLHANSRLRMERGNGSTEDLTARVLDLASPIGRGQRGLIVA 202

Query: 182 PPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAAR 241
           PP+ GKT+LLQNIA SI  NHP+C L+VLLIDERPEEVT+MQR V+GEV++STFDE A+R
Sbjct: 203 PPKAGKTMLLQNIAQSIAYNHPDCVLMVLLIDERPEEVTEMQRLVKGEVVASTFDEPASR 262

Query: 242 HVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPK 301
           HVQVAEMVI KAK LVE+  DV+ILLDSITRL RAYN ++P+SGK+LTGGVDANAL RPK
Sbjct: 263 HVQVAEMVIEKAKRLVEHKKDVIILLDSITRLARAYNTVVPASGKVLTGGVDANALHRPK 322

Query: 302 RFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAM 361
           RFFGAARN++EGGSLTII TAL+DTGS+MDEVI+EEFKGTGN E+ L RKIA+KR+FPA+
Sbjct: 323 RFFGAARNVEEGGSLTIIATALIDTGSKMDEVIYEEFKGTGNMELHLSRKIAEKRVFPAI 382

Query: 362 DIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
           D  +SGTRKE+LL  +++LQK+++LR+I+  M   DA+EFLI+KL  TK N DFF  M +
Sbjct: 383 DYNRSGTRKEELLTTQEELQKMWILRKIIHPMGEIDAMEFLINKLAMTKTNDDFFEMMKR 442


>gi|15833970|ref|NP_312743.1| transcription termination factor Rho [Escherichia coli O157:H7 str.
           Sakai]
 gi|16131639|ref|NP_418230.1| transcription termination factor [Escherichia coli str. K-12
           substr. MG1655]
 gi|30064922|ref|NP_839093.1| transcription termination factor Rho [Shigella flexneri 2a str.
           2457T]
 gi|56480435|ref|NP_709586.2| transcription termination factor Rho [Shigella flexneri 2a str.
           301]
 gi|74314297|ref|YP_312716.1| transcription termination factor Rho [Shigella sonnei Ss046]
 gi|82546137|ref|YP_410084.1| transcription termination factor Rho [Shigella boydii Sb227]
 gi|82779036|ref|YP_405385.1| transcription termination factor Rho [Shigella dysenteriae Sd197]
 gi|89110234|ref|AP_004014.1| transcription termination factor [Escherichia coli str. K-12
           substr. W3110]
 gi|157155913|ref|YP_001465263.1| transcription termination factor Rho [Escherichia coli E24377A]
 gi|157163256|ref|YP_001460574.1| transcription termination factor Rho [Escherichia coli HS]
 gi|168751740|ref|ZP_02776762.1| transcription termination factor Rho [Escherichia coli O157:H7 str.
           EC4113]
 gi|168753676|ref|ZP_02778683.1| transcription termination factor Rho [Escherichia coli O157:H7 str.
           EC4401]
 gi|168764140|ref|ZP_02789147.1| transcription termination factor Rho [Escherichia coli O157:H7 str.
           EC4501]
 gi|168768060|ref|ZP_02793067.1| transcription termination factor Rho [Escherichia coli O157:H7 str.
           EC4486]
 gi|168775670|ref|ZP_02800677.1| transcription termination factor Rho [Escherichia coli O157:H7 str.
           EC4196]
 gi|168780678|ref|ZP_02805685.1| transcription termination factor Rho [Escherichia coli O157:H7 str.
           EC4076]
 gi|168786617|ref|ZP_02811624.1| transcription termination factor Rho [Escherichia coli O157:H7 str.
           EC869]
 gi|168800999|ref|ZP_02826006.1| transcription termination factor Rho [Escherichia coli O157:H7 str.
           EC508]
 gi|170022190|ref|YP_001727144.1| transcription termination factor Rho [Escherichia coli ATCC 8739]
 gi|170083270|ref|YP_001732590.1| transcription termination factor [Escherichia coli str. K-12
           substr. DH10B]
 gi|170683673|ref|YP_001746101.1| transcription termination factor Rho [Escherichia coli SMS-3-5]
 gi|170769817|ref|ZP_02904270.1| transcription termination factor Rho [Escherichia albertii TW07627]
 gi|187732455|ref|YP_001882393.1| transcription termination factor Rho [Shigella boydii CDC 3083-94]
 gi|188494722|ref|ZP_03001992.1| transcription termination factor Rho [Escherichia coli 53638]
 gi|191166125|ref|ZP_03027960.1| transcription termination factor Rho [Escherichia coli B7A]
 gi|191174364|ref|ZP_03035869.1| transcription termination factor Rho [Escherichia coli F11]
 gi|191174433|ref|ZP_03035935.1| transcription termination factor Rho [Escherichia coli F11]
 gi|193066127|ref|ZP_03047182.1| transcription termination factor Rho [Escherichia coli E22]
 gi|193071038|ref|ZP_03051965.1| transcription termination factor Rho [Escherichia coli E110019]
 gi|194429771|ref|ZP_03062286.1| transcription termination factor Rho [Escherichia coli B171]
 gi|194434630|ref|ZP_03066886.1| transcription termination factor Rho [Shigella dysenteriae 1012]
 gi|194438677|ref|ZP_03070765.1| transcription termination factor Rho [Escherichia coli 101-1]
 gi|195938071|ref|ZP_03083453.1| transcription termination factor Rho [Escherichia coli O157:H7 str.
           EC4024]
 gi|208809424|ref|ZP_03251761.1| transcription termination factor Rho [Escherichia coli O157:H7 str.
           EC4206]
 gi|208812033|ref|ZP_03253362.1| transcription termination factor Rho [Escherichia coli O157:H7 str.
           EC4045]
 gi|208819558|ref|ZP_03259878.1| transcription termination factor Rho [Escherichia coli O157:H7 str.
           EC4042]
 gi|209400658|ref|YP_002273300.1| transcription termination factor Rho [Escherichia coli O157:H7 str.
           EC4115]
 gi|209921256|ref|YP_002295340.1| transcription termination factor Rho [Escherichia coli SE11]
 gi|215489111|ref|YP_002331542.1| transcription termination factor Rho [Escherichia coli O127:H6 str.
           E2348/69]
 gi|217324419|ref|ZP_03440503.1| transcription termination factor Rho [Escherichia coli O157:H7 str.
           TW14588]
 gi|218550993|ref|YP_002384784.1| transcription termination factor Rho [Escherichia fergusonii ATCC
           35469]
 gi|218556345|ref|YP_002389259.1| transcription termination factor Rho [Escherichia coli IAI1]
 gi|218560849|ref|YP_002393762.1| transcription termination factor Rho [Escherichia coli S88]
 gi|218692062|ref|YP_002400274.1| transcription termination factor Rho [Escherichia coli ED1a]
 gi|218697500|ref|YP_002405167.1| transcription termination factor Rho [Escherichia coli 55989]
 gi|218707419|ref|YP_002414938.1| transcription termination factor Rho [Escherichia coli UMN026]
 gi|227888634|ref|ZP_04006439.1| transcription termination factor Rho [Escherichia coli 83972]
 gi|238902863|ref|YP_002928659.1| transcription termination factor [Escherichia coli BW2952]
 gi|254795780|ref|YP_003080617.1| transcription termination factor Rho [Escherichia coli O157:H7 str.
           TW14359]
 gi|256021475|ref|ZP_05435340.1| transcription termination factor Rho [Shigella sp. D9]
 gi|256026131|ref|ZP_05439996.1| transcription termination factor Rho [Escherichia sp. 4_1_40B]
 gi|260846441|ref|YP_003224219.1| transcription termination factor Rho [Escherichia coli O103:H2 str.
           12009]
 gi|260857811|ref|YP_003231702.1| transcription termination factor Rho [Escherichia coli O26:H11 str.
           11368]
 gi|260870508|ref|YP_003236910.1| transcription termination factor Rho [Escherichia coli O111:H- str.
           11128]
 gi|261225557|ref|ZP_05939838.1| transcription termination factor [Escherichia coli O157:H7 str.
           FRIK2000]
 gi|261255603|ref|ZP_05948136.1| transcription termination factor Rho [Escherichia coli O157:H7 str.
           FRIK966]
 gi|291285198|ref|YP_003502016.1| Transcription termination factor rho [Escherichia coli O55:H7 str.
           CB9615]
 gi|293407412|ref|ZP_06651332.1| transcription termination factor Rho [Escherichia coli FVEC1412]
 gi|293413226|ref|ZP_06655888.1| transcription termination factor Rho [Escherichia coli B354]
 gi|293417248|ref|ZP_06659873.1| transcription termination factor Rho [Escherichia coli B185]
 gi|293468100|ref|ZP_06664512.1| transcription termination factor Rho [Escherichia coli B088]
 gi|298383152|ref|ZP_06992746.1| transcription termination factor rho [Escherichia coli FVEC1302]
 gi|300818748|ref|ZP_07098955.1| transcription termination factor Rho [Escherichia coli MS 107-1]
 gi|300823314|ref|ZP_07103445.1| transcription termination factor Rho [Escherichia coli MS 119-7]
 gi|300900673|ref|ZP_07118826.1| transcription termination factor Rho [Escherichia coli MS 198-1]
 gi|300904034|ref|ZP_07121916.1| transcription termination factor Rho [Escherichia coli MS 84-1]
 gi|300921512|ref|ZP_07137856.1| transcription termination factor Rho [Escherichia coli MS 115-1]
 gi|300923282|ref|ZP_07139331.1| transcription termination factor Rho [Escherichia coli MS 182-1]
 gi|300930054|ref|ZP_07145484.1| transcription termination factor Rho [Escherichia coli MS 187-1]
 gi|300940003|ref|ZP_07154628.1| transcription termination factor Rho [Escherichia coli MS 21-1]
 gi|300947360|ref|ZP_07161556.1| transcription termination factor Rho [Escherichia coli MS 116-1]
 gi|300955215|ref|ZP_07167610.1| transcription termination factor Rho [Escherichia coli MS 175-1]
 gi|300979311|ref|ZP_07174495.1| transcription termination factor Rho [Escherichia coli MS 200-1]
 gi|300985805|ref|ZP_07177597.1| transcription termination factor Rho [Escherichia coli MS 45-1]
 gi|301021427|ref|ZP_07185451.1| transcription termination factor Rho [Escherichia coli MS 69-1]
 gi|301028995|ref|ZP_07192152.1| transcription termination factor Rho [Escherichia coli MS 196-1]
 gi|301047338|ref|ZP_07194423.1| transcription termination factor Rho [Escherichia coli MS 185-1]
 gi|301303677|ref|ZP_07209798.1| transcription termination factor Rho [Escherichia coli MS 124-1]
 gi|301325472|ref|ZP_07218955.1| transcription termination factor Rho [Escherichia coli MS 78-1]
 gi|301646152|ref|ZP_07246051.1| transcription termination factor Rho [Escherichia coli MS 146-1]
 gi|306815179|ref|ZP_07449332.1| transcription termination factor Rho [Escherichia coli NC101]
 gi|307140483|ref|ZP_07499839.1| transcription termination factor Rho [Escherichia coli H736]
 gi|307313641|ref|ZP_07593261.1| transcription termination factor Rho [Escherichia coli W]
 gi|309784494|ref|ZP_07679132.1| transcription termination factor Rho [Shigella dysenteriae 1617]
 gi|309796278|ref|ZP_07690688.1| transcription termination factor Rho [Escherichia coli MS 145-7]
 gi|312969489|ref|ZP_07783691.1| transcription termination factor Rho [Escherichia coli 2362-75]
 gi|312971935|ref|ZP_07786109.1| transcription termination factor Rho [Escherichia coli 1827-70]
 gi|331660127|ref|ZP_08361063.1| transcription termination factor Rho [Escherichia coli TA206]
 gi|331665428|ref|ZP_08366327.1| transcription termination factor Rho [Escherichia coli TA143]
 gi|331670627|ref|ZP_08371464.1| transcription termination factor Rho [Escherichia coli TA271]
 gi|331685501|ref|ZP_08386085.1| transcription termination factor Rho [Escherichia coli H299]
 gi|84027884|sp|P0AG32|RHO_ECO57 RecName: Full=Transcription termination factor Rho; AltName:
           Full=ATP-dependent helicase Rho
 gi|84027885|sp|P0AG31|RHO_ECOL6 RecName: Full=Transcription termination factor Rho; AltName:
           Full=ATP-dependent helicase Rho
 gi|84027886|sp|P0AG30|RHO_ECOLI RecName: Full=Transcription termination factor Rho; AltName:
           Full=ATP-dependent helicase Rho
 gi|84027887|sp|P0AG33|RHO_SHIFL RecName: Full=Transcription termination factor Rho; AltName:
           Full=ATP-dependent helicase Rho
 gi|34811292|pdb|1PVO|A Chain A, X-Ray Crystal Structure Of Rho Transcription Termination
           Factor In Complex With Ssrna Substrate And Anppnp
 gi|34811293|pdb|1PVO|B Chain B, X-Ray Crystal Structure Of Rho Transcription Termination
           Factor In Complex With Ssrna Substrate And Anppnp
 gi|34811294|pdb|1PVO|C Chain C, X-Ray Crystal Structure Of Rho Transcription Termination
           Factor In Complex With Ssrna Substrate And Anppnp
 gi|34811295|pdb|1PVO|D Chain D, X-Ray Crystal Structure Of Rho Transcription Termination
           Factor In Complex With Ssrna Substrate And Anppnp
 gi|34811296|pdb|1PVO|E Chain E, X-Ray Crystal Structure Of Rho Transcription Termination
           Factor In Complex With Ssrna Substrate And Anppnp
 gi|34811297|pdb|1PVO|F Chain F, X-Ray Crystal Structure Of Rho Transcription Termination
           Factor In Complex With Ssrna Substrate And Anppnp
 gi|56554635|pdb|1XPR|A Chain A, Structural Mechanism Of Inhibition Of The Rho
           Transcription Termination Factor By The Antibiotic
           5a-Formylbicyclomycin (Fb)
 gi|56554637|pdb|1XPR|B Chain B, Structural Mechanism Of Inhibition Of The Rho
           Transcription Termination Factor By The Antibiotic
           5a-Formylbicyclomycin (Fb)
 gi|56554639|pdb|1XPR|C Chain C, Structural Mechanism Of Inhibition Of The Rho
           Transcription Termination Factor By The Antibiotic
           5a-Formylbicyclomycin (Fb)
 gi|56554641|pdb|1XPR|D Chain D, Structural Mechanism Of Inhibition Of The Rho
           Transcription Termination Factor By The Antibiotic
           5a-Formylbicyclomycin (Fb)
 gi|56554643|pdb|1XPR|E Chain E, Structural Mechanism Of Inhibition Of The Rho
           Transcription Termination Factor By The Antibiotic
           5a-Formylbicyclomycin (Fb)
 gi|56554645|pdb|1XPR|F Chain F, Structural Mechanism Of Inhibition Of The Rho
           Transcription Termination Factor By The Antibiotic
           5a-Formylbicyclomycin (Fb)
 gi|56554647|pdb|1XPU|A Chain A, Structural Mechanism Of Inhibition Of The Rho
           Transcription Termination Factor By The Antibiotic
           5a-(3- Formylphenylsulfanyl)-Dihydrobicyclomycin (Fpdb)
 gi|56554649|pdb|1XPU|B Chain B, Structural Mechanism Of Inhibition Of The Rho
           Transcription Termination Factor By The Antibiotic
           5a-(3- Formylphenylsulfanyl)-Dihydrobicyclomycin (Fpdb)
 gi|56554651|pdb|1XPU|C Chain C, Structural Mechanism Of Inhibition Of The Rho
           Transcription Termination Factor By The Antibiotic
           5a-(3- Formylphenylsulfanyl)-Dihydrobicyclomycin (Fpdb)
 gi|56554653|pdb|1XPU|D Chain D, Structural Mechanism Of Inhibition Of The Rho
           Transcription Termination Factor By The Antibiotic
           5a-(3- Formylphenylsulfanyl)-Dihydrobicyclomycin (Fpdb)
 gi|56554655|pdb|1XPU|E Chain E, Structural Mechanism Of Inhibition Of The Rho
           Transcription Termination Factor By The Antibiotic
           5a-(3- Formylphenylsulfanyl)-Dihydrobicyclomycin (Fpdb)
 gi|56554657|pdb|1XPU|F Chain F, Structural Mechanism Of Inhibition Of The Rho
           Transcription Termination Factor By The Antibiotic
           5a-(3- Formylphenylsulfanyl)-Dihydrobicyclomycin (Fpdb)
 gi|61680408|pdb|1XPO|A Chain A, Structural Mechanism Of Inhibition Of The Rho
           Transcription Termination Factor By The Antibiotic
           Bicyclomycin
 gi|61680410|pdb|1XPO|B Chain B, Structural Mechanism Of Inhibition Of The Rho
           Transcription Termination Factor By The Antibiotic
           Bicyclomycin
 gi|61680412|pdb|1XPO|C Chain C, Structural Mechanism Of Inhibition Of The Rho
           Transcription Termination Factor By The Antibiotic
           Bicyclomycin
 gi|61680414|pdb|1XPO|D Chain D, Structural Mechanism Of Inhibition Of The Rho
           Transcription Termination Factor By The Antibiotic
           Bicyclomycin
 gi|61680416|pdb|1XPO|E Chain E, Structural Mechanism Of Inhibition Of The Rho
           Transcription Termination Factor By The Antibiotic
           Bicyclomycin
 gi|61680418|pdb|1XPO|F Chain F, Structural Mechanism Of Inhibition Of The Rho
           Transcription Termination Factor By The Antibiotic
           Bicyclomycin
 gi|147607|gb|AAA24532.1| transcription termination factor [Escherichia coli]
 gi|148186|gb|AAA67583.1| transcription termination factor rho [Escherichia coli str. K-12
           substr. MG1655]
 gi|1790217|gb|AAC76788.1| transcription termination factor [Escherichia coli str. K-12
           substr. MG1655]
 gi|13364191|dbj|BAB38139.1| transcription termination factor Rho [Escherichia coli O157:H7 str.
           Sakai]
 gi|30043183|gb|AAP18904.1| transcription termination factor Rho, polarity suppressor [Shigella
           flexneri 2a str. 2457T]
 gi|56383986|gb|AAN45293.2| transcription termination factor Rho, polarity suppressor [Shigella
           flexneri 2a str. 301]
 gi|73857774|gb|AAZ90481.1| transcription termination factor Rho; polarity suppressor [Shigella
           sonnei Ss046]
 gi|81243184|gb|ABB63894.1| transcription termination factor Rho [Shigella dysenteriae Sd197]
 gi|81247548|gb|ABB68256.1| transcription termination factor Rho [Shigella boydii Sb227]
 gi|85676265|dbj|BAE77515.1| transcription termination factor [Escherichia coli str. K12 substr.
           W3110]
 gi|157068936|gb|ABV08191.1| transcription termination factor Rho [Escherichia coli HS]
 gi|157077943|gb|ABV17651.1| transcription termination factor Rho [Escherichia coli E24377A]
 gi|169757118|gb|ACA79817.1| transcription termination factor Rho [Escherichia coli ATCC 8739]
 gi|169891105|gb|ACB04812.1| transcription termination factor [Escherichia coli str. K-12
           substr. DH10B]
 gi|170121255|gb|EDS90186.1| transcription termination factor Rho [Escherichia albertii TW07627]
 gi|170521391|gb|ACB19569.1| transcription termination factor Rho [Escherichia coli SMS-3-5]
 gi|187429447|gb|ACD08721.1| transcription termination factor Rho [Shigella boydii CDC 3083-94]
 gi|187768863|gb|EDU32707.1| transcription termination factor Rho [Escherichia coli O157:H7 str.
           EC4196]
 gi|188014278|gb|EDU52400.1| transcription termination factor Rho [Escherichia coli O157:H7 str.
           EC4113]
 gi|188489921|gb|EDU65024.1| transcription termination factor Rho [Escherichia coli 53638]
 gi|189001536|gb|EDU70522.1| transcription termination factor Rho [Escherichia coli O157:H7 str.
           EC4076]
 gi|189359221|gb|EDU77640.1| transcription termination factor Rho [Escherichia coli O157:H7 str.
           EC4401]
 gi|189362557|gb|EDU80976.1| transcription termination factor Rho [Escherichia coli O157:H7 str.
           EC4486]
 gi|189365819|gb|EDU84235.1| transcription termination factor Rho [Escherichia coli O157:H7 str.
           EC4501]
 gi|189373337|gb|EDU91753.1| transcription termination factor Rho [Escherichia coli O157:H7 str.
           EC869]
 gi|189376810|gb|EDU95226.1| transcription termination factor Rho [Escherichia coli O157:H7 str.
           EC508]
 gi|190903901|gb|EDV63615.1| transcription termination factor Rho [Escherichia coli B7A]
 gi|190905288|gb|EDV64925.1| transcription termination factor Rho [Escherichia coli F11]
 gi|190905341|gb|EDV64975.1| transcription termination factor Rho [Escherichia coli F11]
 gi|192926224|gb|EDV80863.1| transcription termination factor Rho [Escherichia coli E22]
 gi|192955625|gb|EDV86101.1| transcription termination factor Rho [Escherichia coli E110019]
 gi|194412183|gb|EDX28490.1| transcription termination factor Rho [Escherichia coli B171]
 gi|194417149|gb|EDX33262.1| transcription termination factor Rho [Shigella dysenteriae 1012]
 gi|194422481|gb|EDX38480.1| transcription termination factor Rho [Escherichia coli 101-1]
 gi|208729225|gb|EDZ78826.1| transcription termination factor Rho [Escherichia coli O157:H7 str.
           EC4206]
 gi|208733310|gb|EDZ81997.1| transcription termination factor Rho [Escherichia coli O157:H7 str.
           EC4045]
 gi|208739681|gb|EDZ87363.1| transcription termination factor Rho [Escherichia coli O157:H7 str.
           EC4042]
 gi|209162058|gb|ACI39491.1| transcription termination factor Rho [Escherichia coli O157:H7 str.
           EC4115]
 gi|209753488|gb|ACI75051.1| UDP-GlcNAc:undecaprenylphosphate GlcNAc-1-phosphate transferase
           [Escherichia coli]
 gi|209753490|gb|ACI75052.1| UDP-GlcNAc:undecaprenylphosphate GlcNAc-1-phosphate transferase
           [Escherichia coli]
 gi|209753492|gb|ACI75053.1| UDP-GlcNAc:undecaprenylphosphate GlcNAc-1-phosphate transferase
           [Escherichia coli]
 gi|209753494|gb|ACI75054.1| UDP-GlcNAc:undecaprenylphosphate GlcNAc-1-phosphate transferase
           [Escherichia coli]
 gi|209753496|gb|ACI75055.1| UDP-GlcNAc:undecaprenylphosphate GlcNAc-1-phosphate transferase
           [Escherichia coli]
 gi|209914515|dbj|BAG79589.1| transcription termination factor Rho [Escherichia coli SE11]
 gi|215267183|emb|CAS11631.1| transcription termination factor [Escherichia coli O127:H6 str.
           E2348/69]
 gi|217320640|gb|EEC29064.1| transcription termination factor Rho [Escherichia coli O157:H7 str.
           TW14588]
 gi|218354232|emb|CAV00889.1| transcription termination factor [Escherichia coli 55989]
 gi|218358534|emb|CAQ91181.1| transcription termination factor [Escherichia fergusonii ATCC
           35469]
 gi|218363114|emb|CAR00754.1| transcription termination factor [Escherichia coli IAI1]
 gi|218367618|emb|CAR05401.1| transcription termination factor [Escherichia coli S88]
 gi|218429626|emb|CAR10587.2| transcription termination factor [Escherichia coli ED1a]
 gi|218434516|emb|CAR15442.1| transcription termination factor [Escherichia coli UMN026]
 gi|222035484|emb|CAP78229.1| Transcription termination factor rho [Escherichia coli LF82]
 gi|227834473|gb|EEJ44939.1| transcription termination factor Rho [Escherichia coli 83972]
 gi|238863679|gb|ACR65677.1| transcription termination factor [Escherichia coli BW2952]
 gi|254595180|gb|ACT74541.1| transcription termination factor [Escherichia coli O157:H7 str.
           TW14359]
 gi|257756460|dbj|BAI27962.1| transcription termination factor Rho [Escherichia coli O26:H11 str.
           11368]
 gi|257761588|dbj|BAI33085.1| transcription termination factor Rho [Escherichia coli O103:H2 str.
           12009]
 gi|257766864|dbj|BAI38359.1| transcription termination factor Rho [Escherichia coli O111:H- str.
           11128]
 gi|260451372|gb|ACX41794.1| transcription termination factor Rho [Escherichia coli DH1]
 gi|284923887|emb|CBG36986.1| transcription termination factor [Escherichia coli 042]
 gi|290765071|gb|ADD59032.1| Transcription termination factor rho [Escherichia coli O55:H7 str.
           CB9615]
 gi|291321478|gb|EFE60916.1| transcription termination factor Rho [Escherichia coli B088]
 gi|291425523|gb|EFE98561.1| transcription termination factor Rho [Escherichia coli FVEC1412]
 gi|291431016|gb|EFF04011.1| transcription termination factor Rho [Escherichia coli B185]
 gi|291468174|gb|EFF10671.1| transcription termination factor Rho [Escherichia coli B354]
 gi|294493548|gb|ADE92304.1| transcription termination factor Rho [Escherichia coli IHE3034]
 gi|298276388|gb|EFI17907.1| transcription termination factor rho [Escherichia coli FVEC1302]
 gi|299878038|gb|EFI86249.1| transcription termination factor Rho [Escherichia coli MS 196-1]
 gi|300300755|gb|EFJ57140.1| transcription termination factor Rho [Escherichia coli MS 185-1]
 gi|300308064|gb|EFJ62584.1| transcription termination factor Rho [Escherichia coli MS 200-1]
 gi|300317869|gb|EFJ67653.1| transcription termination factor Rho [Escherichia coli MS 175-1]
 gi|300355822|gb|EFJ71692.1| transcription termination factor Rho [Escherichia coli MS 198-1]
 gi|300398063|gb|EFJ81601.1| transcription termination factor Rho [Escherichia coli MS 69-1]
 gi|300403986|gb|EFJ87524.1| transcription termination factor Rho [Escherichia coli MS 84-1]
 gi|300407956|gb|EFJ91494.1| transcription termination factor Rho [Escherichia coli MS 45-1]
 gi|300411580|gb|EFJ94890.1| transcription termination factor Rho [Escherichia coli MS 115-1]
 gi|300420427|gb|EFK03738.1| transcription termination factor Rho [Escherichia coli MS 182-1]
 gi|300453022|gb|EFK16642.1| transcription termination factor Rho [Escherichia coli MS 116-1]
 gi|300455136|gb|EFK18629.1| transcription termination factor Rho [Escherichia coli MS 21-1]
 gi|300462042|gb|EFK25535.1| transcription termination factor Rho [Escherichia coli MS 187-1]
 gi|300524100|gb|EFK45169.1| transcription termination factor Rho [Escherichia coli MS 119-7]
 gi|300528714|gb|EFK49776.1| transcription termination factor Rho [Escherichia coli MS 107-1]
 gi|300840977|gb|EFK68737.1| transcription termination factor Rho [Escherichia coli MS 124-1]
 gi|300847699|gb|EFK75459.1| transcription termination factor Rho [Escherichia coli MS 78-1]
 gi|301075621|gb|EFK90427.1| transcription termination factor Rho [Escherichia coli MS 146-1]
 gi|305851548|gb|EFM52002.1| transcription termination factor Rho [Escherichia coli NC101]
 gi|306906622|gb|EFN37134.1| transcription termination factor Rho [Escherichia coli W]
 gi|307628846|gb|ADN73150.1| transcription termination factor Rho [Escherichia coli UM146]
 gi|308120160|gb|EFO57422.1| transcription termination factor Rho [Escherichia coli MS 145-7]
 gi|308927600|gb|EFP73069.1| transcription termination factor Rho [Shigella dysenteriae 1617]
 gi|309704222|emb|CBJ03569.1| transcription termination factor [Escherichia coli ETEC H10407]
 gi|310334312|gb|EFQ00517.1| transcription termination factor Rho [Escherichia coli 1827-70]
 gi|312286036|gb|EFR13954.1| transcription termination factor Rho [Escherichia coli 2362-75]
 gi|313647773|gb|EFS12220.1| transcription termination factor Rho [Shigella flexneri 2a str.
           2457T]
 gi|315063078|gb|ADT77405.1| transcription termination factor [Escherichia coli W]
 gi|315138361|dbj|BAJ45520.1| transcription termination factor rho [Escherichia coli DH1]
 gi|315254147|gb|EFU34115.1| transcription termination factor Rho [Escherichia coli MS 85-1]
 gi|315284667|gb|EFU44112.1| transcription termination factor Rho [Escherichia coli MS 110-3]
 gi|315293133|gb|EFU52485.1| transcription termination factor Rho [Escherichia coli MS 153-1]
 gi|315296846|gb|EFU56135.1| transcription termination factor Rho [Escherichia coli MS 16-3]
 gi|315618519|gb|EFU99105.1| transcription termination factor Rho [Escherichia coli 3431]
 gi|320176025|gb|EFW51094.1| Transcription termination factor Rho [Shigella dysenteriae CDC
           74-1112]
 gi|320178073|gb|EFW53053.1| Transcription termination factor Rho [Shigella boydii ATCC 9905]
 gi|320185444|gb|EFW60213.1| Transcription termination factor Rho [Shigella flexneri CDC 796-83]
 gi|320191124|gb|EFW65774.1| Transcription termination factor Rho [Escherichia coli O157:H7 str.
           EC1212]
 gi|320197595|gb|EFW72207.1| Transcription termination factor Rho [Escherichia coli WV_060327]
 gi|320198509|gb|EFW73110.1| Transcription termination factor Rho [Escherichia coli EC4100B]
 gi|320639267|gb|EFX08889.1| transcription termination factor Rho [Escherichia coli O157:H7 str.
           G5101]
 gi|320644652|gb|EFX13702.1| transcription termination factor Rho [Escherichia coli O157:H- str.
           493-89]
 gi|320649977|gb|EFX18480.1| transcription termination factor Rho [Escherichia coli O157:H- str.
           H 2687]
 gi|320655323|gb|EFX23265.1| transcription termination factor Rho [Escherichia coli O55:H7 str.
           3256-97 TW 07815]
 gi|320660948|gb|EFX28391.1| transcription termination factor Rho [Escherichia coli O55:H7 str.
           USDA 5905]
 gi|320666072|gb|EFX33086.1| transcription termination factor Rho [Escherichia coli O157:H7 str.
           LSU-61]
 gi|323155184|gb|EFZ41368.1| transcription termination factor Rho [Escherichia coli EPECa14]
 gi|323161154|gb|EFZ47072.1| transcription termination factor Rho [Escherichia coli E128010]
 gi|323167636|gb|EFZ53341.1| transcription termination factor Rho [Shigella sonnei 53G]
 gi|323173399|gb|EFZ59028.1| transcription termination factor Rho [Escherichia coli LT-68]
 gi|323177792|gb|EFZ63376.1| transcription termination factor Rho [Escherichia coli 1180]
 gi|323182555|gb|EFZ67959.1| transcription termination factor Rho [Escherichia coli 1357]
 gi|323189495|gb|EFZ74775.1| transcription termination factor Rho [Escherichia coli RN587/1]
 gi|323380858|gb|ADX53126.1| transcription termination factor Rho [Escherichia coli KO11]
 gi|323934173|gb|EGB30604.1| transcription termination protein Rho [Escherichia coli E1520]
 gi|323938921|gb|EGB35140.1| transcription termination proteinRho [Escherichia coli E482]
 gi|323943815|gb|EGB39910.1| transcription termination protein Rho [Escherichia coli H120]
 gi|323949333|gb|EGB45223.1| transcription termination proteinRho [Escherichia coli H252]
 gi|323954097|gb|EGB49894.1| transcription termination proteinRho [Escherichia coli H263]
 gi|323959039|gb|EGB54708.1| transcription termination proteinRho [Escherichia coli H489]
 gi|323964030|gb|EGB59520.1| transcription termination proteinRho [Escherichia coli M863]
 gi|323969376|gb|EGB64675.1| transcription termination proteinRho [Escherichia coli TA007]
 gi|323974366|gb|EGB69494.1| transcription termination proteinRho [Escherichia coli TW10509]
 gi|324007442|gb|EGB76661.1| transcription termination factor Rho [Escherichia coli MS 57-2]
 gi|324014728|gb|EGB83947.1| transcription termination factor Rho [Escherichia coli MS 60-1]
 gi|324016168|gb|EGB85387.1| transcription termination factor Rho [Escherichia coli MS 117-3]
 gi|324111009|gb|EGC04996.1| transcription termination proteinRho [Escherichia fergusonii B253]
 gi|324115754|gb|EGC09689.1| transcription termination proteinRho [Escherichia coli E1167]
 gi|325499246|gb|EGC97105.1| transcription termination factor Rho [Escherichia fergusonii
           ECD227]
 gi|326344240|gb|EGD68000.1| Transcription termination factor Rho [Escherichia coli O157:H7 str.
           1125]
 gi|326347933|gb|EGD71647.1| Transcription termination factor Rho [Escherichia coli O157:H7 str.
           1044]
 gi|327250634|gb|EGE62340.1| transcription termination factor Rho [Escherichia coli STEC_7v]
 gi|330908084|gb|EGH36603.1| transcription termination factor Rho [Escherichia coli AA86]
 gi|331052695|gb|EGI24730.1| transcription termination factor Rho [Escherichia coli TA206]
 gi|331057326|gb|EGI29315.1| transcription termination factor Rho [Escherichia coli TA143]
 gi|331062100|gb|EGI34022.1| transcription termination factor Rho [Escherichia coli TA271]
 gi|331077202|gb|EGI48416.1| transcription termination factor Rho [Escherichia coli H299]
 gi|332084703|gb|EGI89891.1| transcription termination factor Rho [Shigella boydii 5216-82]
 gi|332084959|gb|EGI90141.1| transcription termination factor Rho [Shigella dysenteriae 155-74]
 gi|332089051|gb|EGI94162.1| transcription termination factor Rho [Shigella boydii 3594-74]
 gi|332345762|gb|AEE59096.1| transcription termination factor Rho [Escherichia coli UMNK88]
 gi|332750993|gb|EGJ81398.1| transcription termination factor Rho [Shigella flexneri 4343-70]
 gi|332751082|gb|EGJ81486.1| transcription termination factor Rho [Shigella flexneri K-671]
 gi|332751913|gb|EGJ82308.1| transcription termination factor Rho [Shigella flexneri 2747-71]
 gi|332764376|gb|EGJ94611.1| transcription termination factor Rho [Shigella flexneri 2930-71]
 gi|332996855|gb|EGK16475.1| transcription termination factor Rho [Shigella flexneri VA-6]
 gi|332997907|gb|EGK17514.1| transcription termination factor Rho [Shigella flexneri K-218]
 gi|332998276|gb|EGK17878.1| transcription termination factor Rho [Shigella flexneri K-272]
 gi|333013592|gb|EGK32959.1| transcription termination factor Rho [Shigella flexneri K-304]
 gi|333013815|gb|EGK33178.1| transcription termination factor Rho [Shigella flexneri K-227]
          Length = 419

 Score =  580 bits (1494), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 274/418 (65%), Positives = 344/418 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELKN   ++L+   E++ +EN   MRKQ+++F+ILK  +    +I G+GV+E+LQD
Sbjct: 1   MNLTELKNTPVSELITLGENMGLENLARMRKQDIIFAILKQHAKSGEDIFGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P+EGERYFALLKVN +N
Sbjct: 61  GFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNEVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           FD PE  RNKI F+NLTPL+ + R  ME  N   +D+++RV+DL +PIG+GQR LIVAPP
Sbjct: 121 FDKPENARNKILFENLTPLHANSRLRMERGNGSTEDLTARVLDLASPIGRGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA SI  NHP+C L+VLLIDERPEEVT+MQR V+GEV++STFDE A+RHV
Sbjct: 181 KAGKTMLLQNIAQSIAYNHPDCVLMVLLIDERPEEVTEMQRLVKGEVVASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DV+ILLDSITRL RAYN ++P+SGK+LTGGVDANAL RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVIILLDSITRLARAYNTVVPASGKVLTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TAL+DTGS+MDEVI+EEFKGTGN E+ L RKIA+KR+FPA+D 
Sbjct: 301 FGAARNVEEGGSLTIIATALIDTGSKMDEVIYEEFKGTGNMELHLSRKIAEKRVFPAIDY 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            +SGTRKE+LL  +++LQK+++LR+I+  M   DA+EFLI+KL  TK N DFF  M +
Sbjct: 361 NRSGTRKEELLTTQEELQKMWILRKIIHPMGEIDAMEFLINKLAMTKTNDDFFEMMKR 418


>gi|260775116|ref|ZP_05884015.1| transcription termination factor Rho [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|323494191|ref|ZP_08099306.1| transcription termination factor Rho [Vibrio brasiliensis LMG
           20546]
 gi|260609033|gb|EEX35193.1| transcription termination factor Rho [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|323311585|gb|EGA64734.1| transcription termination factor Rho [Vibrio brasiliensis LMG
           20546]
          Length = 419

 Score =  580 bits (1494), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 278/419 (66%), Positives = 346/419 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELKN+  + L+   ESL +EN   +RKQ+++F+ILK  +    +I G+GV+E+LQD
Sbjct: 1   MNLTELKNRPVSDLVKLGESLGLENLARLRKQDIIFAILKAHAKSGEDIFGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGD++ G IR P++GERYFALLKVN +N
Sbjct: 61  GFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDSIAGKIRPPKDGERYFALLKVNTVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
            D P+  RNKI F+NLTPL+ ++R  ME  N   +DI++RV+DL +PIGKGQR LIVAPP
Sbjct: 121 DDKPDNARNKILFENLTPLHANERMVMERGNGSTEDITARVLDLASPIGKGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA SI  NHPEC L+VLLIDERPEEVT+MQR V+GEV++STFDE A+RHV
Sbjct: 181 KAGKTMLLQNIAQSIAYNHPECELMVLLIDERPEEVTEMQRLVKGEVVASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANAL RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVVPSSGKVLTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTI+ TALVDTGS+MDEVI+EEFKGTGN EI L RKIA+KR+FPA+D 
Sbjct: 301 FGAARNVEEGGSLTILATALVDTGSKMDEVIYEEFKGTGNMEIHLNRKIAEKRVFPAIDF 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQ 422
            +SGTR+E+LL + ++LQK+++LR+IV  M   DA+EFLIDKL  TK N +FF +M +Q
Sbjct: 361 NRSGTRREELLTKNEELQKMWILRKIVHPMGEIDAMEFLIDKLAMTKTNDEFFDAMRRQ 419


>gi|218701304|ref|YP_002408933.1| transcription termination factor Rho [Escherichia coli IAI39]
 gi|218371290|emb|CAR19124.1| transcription termination factor [Escherichia coli IAI39]
          Length = 419

 Score =  580 bits (1494), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 274/418 (65%), Positives = 344/418 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELKN   ++L+   E++ +EN   MRKQ+++F+ILK  +    +I G+GV+E+LQD
Sbjct: 1   MNLTELKNTPVSELITLGENMGLENLARMRKQDIIFAILKQHAKSGEDIFGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P+EGERYFALLKVN +N
Sbjct: 61  GFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNEVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           FD PE  RNKI F+NLTPL+ + R  ME  N   +D+++RV+DL +PIG+GQR LIVAPP
Sbjct: 121 FDKPENARNKILFENLTPLHANSRLRMERGNGSTEDLTARVLDLASPIGRGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA SI  NHP+C L+VLLIDERPEEVT+MQR V+GEV++STFDE A+RHV
Sbjct: 181 KAGKTMLLQNIAQSIAYNHPDCVLMVLLIDERPEEVTEMQRLVKGEVVASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DV+ILLDSITRL RAYN ++P+SGK+LTGGVDANAL RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVIILLDSITRLARAYNTVVPASGKVLTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TAL+DTGS+MDEVI+EEFKGTGN E+ L RKIA+KR+FPA+D 
Sbjct: 301 FGAARNVEEGGSLTIIATALIDTGSKMDEVIYEEFKGTGNMELHLSRKIAEKRVFPAIDY 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            +SGTRKE+LL  +++LQK+++LR+I+  M   DA+EFLI+KL  TK N DFF  M +
Sbjct: 361 NRSGTRKEELLTTQEELQKMWILRKIIHPMGEIDAMEFLINKLAMTKANDDFFEMMKR 418


>gi|269962286|ref|ZP_06176638.1| transcription termination factor Rho [Vibrio harveyi 1DA3]
 gi|269832989|gb|EEZ87096.1| transcription termination factor Rho [Vibrio harveyi 1DA3]
          Length = 419

 Score =  579 bits (1493), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 278/419 (66%), Positives = 346/419 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELKN+  + L+   ESL +EN   +RKQ+++F+ILK  +    +I G+GV+E+LQD
Sbjct: 1   MNLTELKNRPVSDLVKLGESLGLENLARLRKQDIIFAILKAHAKGGEDIFGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGD++ G IR P++GERYFALLKVN +N
Sbjct: 61  GFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDSIAGKIRPPKDGERYFALLKVNTVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
            D P+  RNKI F+NLTPL+ ++R  ME  N   +DI++RV+DL +PIGKGQR LIVAPP
Sbjct: 121 DDKPDNARNKILFENLTPLHANERMVMERGNGSTEDITARVLDLASPIGKGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA SI  NHPEC L+VLLIDERPEEVT+MQR V+GEV++STFDE A+RHV
Sbjct: 181 KAGKTMLLQNIAQSIAYNHPECELMVLLIDERPEEVTEMQRLVKGEVVASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANAL RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVVPSSGKVLTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTI+ TALVDTGS+MDEVI+EEFKGTGN EI L RKIA+KR+FPA+D 
Sbjct: 301 FGAARNVEEGGSLTILATALVDTGSKMDEVIYEEFKGTGNMEIHLNRKIAEKRVFPAIDF 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQ 422
            +SGTR+E+LL + ++LQK+++LR+IV  M   DA+EFLIDKL  TK N +FF +M +Q
Sbjct: 361 NRSGTRREELLTKNEELQKMWILRKIVHPMGEIDAMEFLIDKLAMTKTNDEFFDAMRRQ 419


>gi|160872678|ref|ZP_02062810.1| transcription termination factor Rho [Rickettsiella grylli]
 gi|159121477|gb|EDP46815.1| transcription termination factor Rho [Rickettsiella grylli]
          Length = 418

 Score =  579 bits (1493), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 278/418 (66%), Positives = 347/418 (83%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK  SP +L+A AE L+I+    + K++++FSILK L+ R  +I G+GV+E+L D
Sbjct: 1   MNLTELKKNSPAELVAIAEELKIDGLGRLHKKDMIFSILKALAKRGEDIYGDGVLEILPD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS +A+YLAGPDDIYVSPSQI+ F+L TGDTV G IR P+E ERYFALLKV+ IN
Sbjct: 61  GFGFLRSAEASYLAGPDDIYVSPSQIRRFNLHTGDTVSGKIRPPKESERYFALLKVSEIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           FD  E  +N++ F+NLTPL+PD+R  +E  N   +DI++R+IDL+AP GKGQR LIV+PP
Sbjct: 121 FDTSENAKNRVLFENLTPLFPDERVQLERGNGSTEDITARIIDLVAPTGKGQRGLIVSPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+++QNIA SI  N PECYLIVLLIDERPEEVTDM+RSV+GEVI+STFDE A RHV
Sbjct: 181 KAGKTMMMQNIAQSISHNCPECYLIVLLIDERPEEVTDMRRSVRGEVIASTFDEPATRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAE+VI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRPKRF
Sbjct: 241 QVAEIVIEKAKRLVEHKKDVVILLDSITRLARAYNTVIPSSGKVLTGGVDANALQRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TALVDTGS+MD+VI+EEFKGTGN EI L+R+IA+KRI+PA+ +
Sbjct: 301 FGAARNIEEGGSLTIIATALVDTGSKMDDVIYEEFKGTGNMEIHLDRRIAEKRIYPAIHL 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            +SGTR+E+LL +   LQK+++LR+I+ SM+   A+EFLI++LK TK N +FF SM K
Sbjct: 361 NRSGTRREELLAKPDVLQKMWILRKILQSMDEVSAMEFLIERLKNTKTNDEFFDSMKK 418


>gi|290513185|ref|ZP_06552547.1| transcription termination factor Rho [Klebsiella sp. 1_1_55]
 gi|289774396|gb|EFD82402.1| transcription termination factor Rho [Klebsiella sp. 1_1_55]
          Length = 443

 Score =  579 bits (1493), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 274/420 (65%), Positives = 345/420 (82%)

Query: 2   SEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVL 61
           + M L ELKN   ++L+   E++ +EN   MRKQ+++F+ILK  S    +I G+GV+E+L
Sbjct: 23  TTMNLTELKNTPVSELITLGENMGLENLARMRKQDIIFAILKQHSKSGEDIFGDGVLEIL 82

Query: 62  QDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNA 121
           QDGFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P+EGERYFALLKVN 
Sbjct: 83  QDGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNE 142

Query: 122 INFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVA 181
           +N+D PE  RNKI F+NLTPL+ + R  ME  N   +D+++RV+DL +PIG+GQR LIVA
Sbjct: 143 VNYDKPENARNKILFENLTPLHANSRLRMERGNGSTEDLTARVLDLASPIGRGQRGLIVA 202

Query: 182 PPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAAR 241
           PP+ GKT+LLQNIA SI  NHP+C L+VLLIDERPEEVT+MQR V+GEV++STFDE A+R
Sbjct: 203 PPKAGKTMLLQNIAQSIAYNHPDCVLMVLLIDERPEEVTEMQRLVKGEVVASTFDEPASR 262

Query: 242 HVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPK 301
           HVQVAEMVI KAK LVE+  DV+ILLDSITRL RAYN ++P+SGK+LTGGVDANAL RPK
Sbjct: 263 HVQVAEMVIEKAKRLVEHKKDVIILLDSITRLARAYNTVVPASGKVLTGGVDANALHRPK 322

Query: 302 RFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAM 361
           RFFGAARN++EGGSLTII TAL+DTGS+MDEVI+EEFKGTGN E+ L RKIA+KR+FPA+
Sbjct: 323 RFFGAARNVEEGGSLTIIATALIDTGSKMDEVIYEEFKGTGNMELHLSRKIAEKRVFPAI 382

Query: 362 DIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
           D  +SGTRKE+LL  +++LQK+++LR+I+  M   DA+EFLI+KL  TK N DFF  M +
Sbjct: 383 DYNRSGTRKEELLTTQEELQKMWILRKIIHPMGEIDAMEFLINKLAMTKTNDDFFDMMKR 442


>gi|238892387|ref|YP_002917121.1| transcription termination factor Rho [Klebsiella pneumoniae
           NTUH-K2044]
 gi|238544703|dbj|BAH61054.1| transcription termination factor [Klebsiella pneumoniae subsp.
           pneumoniae NTUH-K2044]
          Length = 443

 Score =  579 bits (1492), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 274/420 (65%), Positives = 345/420 (82%)

Query: 2   SEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVL 61
           + M L ELKN   ++L+   E++ +EN   MRKQ+++F+ILK  S    +I G+GV+E+L
Sbjct: 23  TTMNLTELKNTPVSELITLGENMGLENLARMRKQDIIFAILKQHSKSGEDIFGDGVLEIL 82

Query: 62  QDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNA 121
           QDGFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P+EGERYFALLKVN 
Sbjct: 83  QDGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNE 142

Query: 122 INFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVA 181
           +N+D PE  RNKI F+NLTPL+ + R  ME  N   +D+++RV+DL +PIG+GQR LIVA
Sbjct: 143 VNYDKPENARNKILFENLTPLHANSRLRMERGNGSTEDLTARVLDLASPIGRGQRGLIVA 202

Query: 182 PPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAAR 241
           PP+ GKT+LLQNIA SI  NHP+C L+VLLIDERPEEVT+MQR V+GEV++STFDE A+R
Sbjct: 203 PPKAGKTMLLQNIAQSIAYNHPDCVLMVLLIDERPEEVTEMQRLVKGEVVASTFDEPASR 262

Query: 242 HVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPK 301
           HVQVAEMVI KAK LVE+  DV+ILLDSITRL RAYN ++P+SGK+LTGGVDANAL RPK
Sbjct: 263 HVQVAEMVIEKAKRLVEHKKDVIILLDSITRLARAYNTVVPASGKVLTGGVDANALHRPK 322

Query: 302 RFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAM 361
           RFFGAARN++EGGSLTII TAL+DTGS+MDEVI+EEFKGTGN E+ L RKIA+KR+FPA+
Sbjct: 323 RFFGAARNVEEGGSLTIIATALIDTGSKMDEVIYEEFKGTGNMELHLSRKIAEKRVFPAI 382

Query: 362 DIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
           D  +SGTRKE+LL  +++LQK+++LR+I+  M   DA+EFLI+KL  TK N DFF  M +
Sbjct: 383 DYNRSGTRKEELLTTQEELQKMWILRKIIHPMGEIDAMEFLINKLAMTKTNDDFFDMMKR 442


>gi|152972776|ref|YP_001337922.1| transcription termination factor Rho [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|206576949|ref|YP_002241150.1| transcription termination factor Rho [Klebsiella pneumoniae 342]
 gi|262040902|ref|ZP_06014128.1| transcription termination factor rho [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|288937789|ref|YP_003441848.1| transcription termination factor Rho [Klebsiella variicola At-22]
 gi|330012117|ref|ZP_08307279.1| transcription termination factor Rho [Klebsiella sp. MS 92-3]
 gi|150957625|gb|ABR79655.1| transcription termination factor Rho [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|206566007|gb|ACI07783.1| transcription termination factor Rho [Klebsiella pneumoniae 342]
 gi|259041791|gb|EEW42836.1| transcription termination factor rho [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|288892498|gb|ADC60816.1| transcription termination factor Rho [Klebsiella variicola At-22]
 gi|328533932|gb|EGF60591.1| transcription termination factor Rho [Klebsiella sp. MS 92-3]
          Length = 419

 Score =  579 bits (1492), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 274/418 (65%), Positives = 344/418 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELKN   ++L+   E++ +EN   MRKQ+++F+ILK  S    +I G+GV+E+LQD
Sbjct: 1   MNLTELKNTPVSELITLGENMGLENLARMRKQDIIFAILKQHSKSGEDIFGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P+EGERYFALLKVN +N
Sbjct: 61  GFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNEVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           +D PE  RNKI F+NLTPL+ + R  ME  N   +D+++RV+DL +PIG+GQR LIVAPP
Sbjct: 121 YDKPENARNKILFENLTPLHANSRLRMERGNGSTEDLTARVLDLASPIGRGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA SI  NHP+C L+VLLIDERPEEVT+MQR V+GEV++STFDE A+RHV
Sbjct: 181 KAGKTMLLQNIAQSIAYNHPDCVLMVLLIDERPEEVTEMQRLVKGEVVASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DV+ILLDSITRL RAYN ++P+SGK+LTGGVDANAL RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVIILLDSITRLARAYNTVVPASGKVLTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TAL+DTGS+MDEVI+EEFKGTGN E+ L RKIA+KR+FPA+D 
Sbjct: 301 FGAARNVEEGGSLTIIATALIDTGSKMDEVIYEEFKGTGNMELHLSRKIAEKRVFPAIDY 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            +SGTRKE+LL  +++LQK+++LR+I+  M   DA+EFLI+KL  TK N DFF  M +
Sbjct: 361 NRSGTRKEELLTTQEELQKMWILRKIIHPMGEIDAMEFLINKLAMTKTNDDFFDMMKR 418


>gi|329114994|ref|ZP_08243749.1| Transcription termination factor Rho [Acetobacter pomorum DM001]
 gi|326695437|gb|EGE47123.1| Transcription termination factor Rho [Acetobacter pomorum DM001]
          Length = 399

 Score =  579 bits (1492), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 273/398 (68%), Positives = 336/398 (84%), Gaps = 14/398 (3%)

Query: 37  LMFSILKVLSGRDVEIIGEGVIEVLQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKT 96
           +MF+ILK L+  D  I GEG +E++ DGFG+LRSP++NYL GPDDIY+SP+Q++ F+L+T
Sbjct: 1   MMFAILKALADNDQAIYGEGTLEIMHDGFGYLRSPESNYLPGPDDIYISPTQVRRFALRT 60

Query: 97  GDTVEGSIRAPREGERYFALLKVNAINFDVPERVRNKIHFDNLTPLYPDKRFNMELNN-- 154
           GDTVEG IRAPR+GERYF++LK+N INF+ P+ VR++I+FDNLTPLYP++R  ME+ +  
Sbjct: 61  GDTVEGQIRAPRDGERYFSMLKINTINFEPPDAVRHRINFDNLTPLYPERRLQMEVESQA 120

Query: 155 --PE----------NKDISSRVIDLIAPIGKGQRSLIVAPPRTGKTILLQNIAHSIKKNH 202
             PE           KD + RVIDL++PIG GQR+LIVAPPR+GKT++LQ+IA SI  NH
Sbjct: 121 TAPEPKSEKGKKSAQKDFTPRVIDLVSPIGMGQRALIVAPPRSGKTVMLQSIASSISANH 180

Query: 203 PECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHVQVAEMVIAKAKCLVEYGLD 262
           PE +LIVLLIDERPEEVTDM RSV+GEVI+STFDE A RHVQV EMV+ KAK LVE+  D
Sbjct: 181 PEVFLIVLLIDERPEEVTDMARSVRGEVIASTFDEPAHRHVQVTEMVLEKAKRLVEHKRD 240

Query: 263 VVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRFFGAARNIKEGGSLTIIGTA 322
           VVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRPKRFFGAARNI+EGGSLTII TA
Sbjct: 241 VVILLDSITRLARAYNTVVPSSGKVLTGGVDANALQRPKRFFGAARNIEEGGSLTIIATA 300

Query: 323 LVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDIIKSGTRKEDLLVERQDLQK 382
           L+DTGSRMDEVIFEEFKGTGNSE+VL+RK+ADKR FPA+DI KSGTRKE+LLV+R  L K
Sbjct: 301 LIDTGSRMDEVIFEEFKGTGNSELVLDRKLADKRTFPAIDITKSGTRKEELLVDRATLSK 360

Query: 383 VFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           +++LRRI++ M + DA++FL+DKLK +K N DFF +MN
Sbjct: 361 MWVLRRILAPMGTMDAMDFLLDKLKYSKTNNDFFEAMN 398


>gi|312881439|ref|ZP_07741234.1| transcription termination factor Rho [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309370921|gb|EFP98378.1| transcription termination factor Rho [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 419

 Score =  578 bits (1491), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 278/419 (66%), Positives = 345/419 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELKN+  + L+   ESL +EN   +RKQ+++F+ILK  +    +I G+GV+E+LQD
Sbjct: 1   MNLTELKNRPVSDLVKLGESLGLENLARLRKQDIIFAILKAHAKSGEDIFGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGD++ G IR P++GERYFALLKVN +N
Sbjct: 61  GFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDSIAGKIRPPKDGERYFALLKVNTVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
            D P+  RNKI F+NLTPL+ ++R  ME  N   +DI++RV+DL +PIGKGQR LIVAPP
Sbjct: 121 DDKPDNARNKILFENLTPLHANERMVMERGNGSTEDITARVLDLASPIGKGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA SI  NHPEC L+VLLIDERPEEVT+MQR V+GEV++STFDE A+RHV
Sbjct: 181 KAGKTMLLQNIAQSIAYNHPECELMVLLIDERPEEVTEMQRLVKGEVVASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANAL RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVVPSSGKVLTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TALVDTGS+MDEVI+EEFKGTGN E+ L RKIA+KR+FPA+D 
Sbjct: 301 FGAARNVEEGGSLTIIATALVDTGSKMDEVIYEEFKGTGNMELHLNRKIAEKRVFPAIDF 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQ 422
            +SGTR+E+LL +  +LQK+++LR+IV  M   DA+EFLIDKL  TK N +FF +M +Q
Sbjct: 361 NRSGTRREELLTKNDELQKMWILRKIVHPMGEIDAMEFLIDKLAMTKTNDEFFDAMRRQ 419


>gi|254508554|ref|ZP_05120671.1| transcription termination factor Rho [Vibrio parahaemolyticus 16]
 gi|323495929|ref|ZP_08100996.1| transcription termination factor Rho [Vibrio sinaloensis DSM 21326]
 gi|219548496|gb|EED25504.1| transcription termination factor Rho [Vibrio parahaemolyticus 16]
 gi|323319012|gb|EGA71956.1| transcription termination factor Rho [Vibrio sinaloensis DSM 21326]
          Length = 419

 Score =  578 bits (1491), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 278/419 (66%), Positives = 345/419 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELKN+  + L+   ESL +EN   +RKQ+++F+ILK  +    +I G+GV+E+LQD
Sbjct: 1   MNLTELKNRPVSDLVKLGESLGLENLARLRKQDIIFAILKAHAKSGEDIFGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGD++ G IR P++GERYFALLKVN +N
Sbjct: 61  GFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDSIAGKIRPPKDGERYFALLKVNTVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
            D P+  RNKI F+NLTPL+ ++R  ME  N   +DI++RV+DL +PIGKGQR LIVAPP
Sbjct: 121 DDKPDNARNKILFENLTPLHANERMVMERGNGSTEDITARVLDLASPIGKGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA SI  NHPEC L+VLLIDERPEEVT+MQR V+GEV++STFDE A+RHV
Sbjct: 181 KAGKTMLLQNIAQSIAYNHPECELMVLLIDERPEEVTEMQRLVKGEVVASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANAL RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVVPSSGKVLTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTI+ TALVDTGS+MDEVI+EEFKGTGN EI L RKIA+KR+FPA+D 
Sbjct: 301 FGAARNVEEGGSLTILATALVDTGSKMDEVIYEEFKGTGNMEIHLNRKIAEKRVFPAIDF 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQ 422
            +SGTR+E+LL +  +LQK+++LR+IV  M   DA+EFLIDKL  TK N +FF +M +Q
Sbjct: 361 NRSGTRREELLTKNDELQKMWILRKIVHPMGEIDAMEFLIDKLAMTKTNDEFFDAMRRQ 419


>gi|117621426|ref|YP_854624.1| transcription termination factor Rho [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
 gi|117562833|gb|ABK39781.1| transcription termination factor Rho [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
          Length = 421

 Score =  578 bits (1491), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 278/419 (66%), Positives = 341/419 (81%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELKN   ++L+   ES+ +EN     K++++F+ILK  +    +I G+GV+E+L D
Sbjct: 1   MNLTELKNTPVSELVQLGESMGLENLARAHKKDIIFAILKAHAKGGEDIFGDGVLEILTD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D +YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P+EGERYFALLKVN +N
Sbjct: 61  GFGFLRSADGSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNEVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           +D PE  RNKI F+NLTPL+ ++R  ME  N   +DI++RV+DL +PIGKGQR LIVAPP
Sbjct: 121 YDRPENSRNKILFENLTPLHANERLRMERGNGSTEDITARVLDLASPIGKGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA SI  NHP+C LIVLLIDERPEEVT+MQR V+GEVI+STFDE A+RHV
Sbjct: 181 KAGKTMLLQNIAQSIAYNHPDCELIVLLIDERPEEVTEMQRMVKGEVIASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANAL RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVIPSSGKVLTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TAL+DTGS+MDEVI+EEFKGTGN E+ L RKIA+KR++PA+DI
Sbjct: 301 FGAARNVEEGGSLTIIATALIDTGSKMDEVIYEEFKGTGNMELHLSRKIAEKRVYPAIDI 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQ 422
            +SGTRKE+LL    +LQK+++LR+IV  M   D IEFLIDKL  TK N +FF +M +Q
Sbjct: 361 TRSGTRKEELLTTGDELQKMWILRKIVHPMGEIDGIEFLIDKLAMTKTNDEFFDAMRRQ 419


>gi|153839109|ref|ZP_01991776.1| transcription termination factor Rho [Vibrio parahaemolyticus
           AQ3810]
 gi|149747405|gb|EDM58369.1| transcription termination factor Rho [Vibrio parahaemolyticus
           AQ3810]
          Length = 427

 Score =  578 bits (1491), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 278/421 (66%), Positives = 346/421 (82%)

Query: 2   SEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVL 61
           + M L ELKN+  + L+   ESL +EN   +RKQ+++F+ILK  +    +I G+GV+E+L
Sbjct: 7   TTMNLTELKNRPVSDLVKLGESLGLENLARLRKQDIIFAILKAHAKGGEDIFGDGVLEIL 66

Query: 62  QDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNA 121
           QDGFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGD++ G IR P++GERYFALLKVN 
Sbjct: 67  QDGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDSIAGKIRPPKDGERYFALLKVNT 126

Query: 122 INFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVA 181
           +N D P+  RNKI F+NLTPL+ ++R  ME  N   +DI++RV+DL +PIGKGQR LIVA
Sbjct: 127 VNDDKPDNARNKILFENLTPLHANERMVMERGNGSTEDITARVLDLASPIGKGQRGLIVA 186

Query: 182 PPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAAR 241
           PP+ GKT+LLQNIA SI  NHPEC L+VLLIDERPEEVT+MQR V+GEV++STFDE A+R
Sbjct: 187 PPKAGKTMLLQNIAQSIAYNHPECELMVLLIDERPEEVTEMQRLVKGEVVASTFDEPASR 246

Query: 242 HVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPK 301
           HVQVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANAL RPK
Sbjct: 247 HVQVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVVPSSGKVLTGGVDANALHRPK 306

Query: 302 RFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAM 361
           RFFGAARN++EGGSLTII TALVDTGS+MDEVI+EEFKGTGN E+ L RKIA+KR+FPA+
Sbjct: 307 RFFGAARNVEEGGSLTIIATALVDTGSKMDEVIYEEFKGTGNMELHLNRKIAEKRVFPAI 366

Query: 362 DIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
           D  +SGTR+E+LL +  +LQK+++LR+IV  M   DA+EFLIDKL  TK N +FF +M +
Sbjct: 367 DFNRSGTRREELLTKTDELQKMWILRKIVHPMGEIDAMEFLIDKLAMTKTNDEFFDAMRR 426

Query: 422 Q 422
           Q
Sbjct: 427 Q 427


>gi|308051269|ref|YP_003914835.1| transcription termination factor Rho [Ferrimonas balearica DSM
           9799]
 gi|307633459|gb|ADN77761.1| transcription termination factor Rho [Ferrimonas balearica DSM
           9799]
          Length = 421

 Score =  578 bits (1491), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 275/418 (65%), Positives = 346/418 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK K  ++L+A AES+ +EN    RKQ+++F+ILK  +    +I G+GV+E+LQD
Sbjct: 1   MNLTELKQKPVSELVALAESMGLENLARARKQDILFAILKAHAKSGEDIYGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGD++ G IR P+EGERYFALLKV+ +N
Sbjct: 61  GFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDSISGKIRPPKEGERYFALLKVSEVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           FD PE  R+KI F+NLTPL+ + R  ME  N   +DI++RV+DL +PIGKGQR LIVAPP
Sbjct: 121 FDRPESSRSKILFENLTPLHANDRLRMERGNGSTEDITARVLDLASPIGKGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA SI  NHPEC L+VLLIDERPEEVT+MQR V+GEV++STFDE A+RHV
Sbjct: 181 KAGKTLLLQNIAQSIAYNHPECVLMVLLIDERPEEVTEMQRLVKGEVVASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANAL RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVVPSSGKVLTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TAL+DTGS+MDEVI+EEFKGTGN E+ L RKIA++R+FPA+D 
Sbjct: 301 FGAARNVEEGGSLTIIATALIDTGSKMDEVIYEEFKGTGNMELHLSRKIAERRVFPAIDF 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            +SGTR+E+LL   ++LQK+++LR+I++ M   +A+EFLIDKL  TK N +FF +M +
Sbjct: 361 NRSGTRREELLAGSEELQKMWILRKILNPMQEVEAMEFLIDKLAMTKTNDEFFDAMKR 418


>gi|299138348|ref|ZP_07031527.1| transcription termination factor Rho [Acidobacterium sp. MP5ACTX8]
 gi|298599594|gb|EFI55753.1| transcription termination factor Rho [Acidobacterium sp. MP5ACTX8]
          Length = 416

 Score =  578 bits (1491), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 277/417 (66%), Positives = 345/417 (82%), Gaps = 3/417 (0%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M + ELK KS  +L   A  LEI   + +RKQ+L+F IL+  S ++  I  EGV+E+L D
Sbjct: 1   MTISELKEKSIAELGKLARGLEIPGTSGLRKQDLIFKILQAQSEKEGHIFAEGVLEILPD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           G+GFLRSPD NYL GPDDIYVSPSQI+ F LKTGDT+ G++R+P EGE+YFAL+K+ AIN
Sbjct: 61  GYGFLRSPDYNYLPGPDDIYVSPSQIRKFDLKTGDTISGNVRSPHEGEKYFALVKIEAIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           F+ PE  RNKI FDNLTPLYPD+R  ME      + IS RV+DL+ PIGKGQR LIVAPP
Sbjct: 121 FESPEETRNKILFDNLTPLYPDERIKMETVR---EAISGRVMDLLCPIGKGQRGLIVAPP 177

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           RTGKT+L+Q+IA+SI  NHPE  LIVLLIDERPEEVTDMQRSV+GEVISSTFDE AARHV
Sbjct: 178 RTGKTVLMQSIANSITANHPEVVLIVLLIDERPEEVTDMQRSVKGEVISSTFDEPAARHV 237

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++P SGK+L+GGVD+NALQRPKRF
Sbjct: 238 QVAEMVIEKAKRLVEHKRDVVILLDSITRLARAYNTIVPPSGKVLSGGVDSNALQRPKRF 297

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII +AL+DTGSRMDEVIFEEFKGTGN E++L+RK+ DKR+FPA+DI
Sbjct: 298 FGAARNIEEGGSLTIIASALIDTGSRMDEVIFEEFKGTGNMEVILDRKLVDKRVFPAIDI 357

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
            +SGTRKE+LL+ + DLQ+ ++LR++++ ++  +A+E L DKL +T++N++F ++M+
Sbjct: 358 QRSGTRKEELLIPKDDLQRTWILRKVLNPLSPVEAMELLSDKLGKTRNNQEFLHNMS 414


>gi|328471328|gb|EGF42227.1| transcription termination factor Rho [Vibrio parahaemolyticus
           10329]
          Length = 419

 Score =  578 bits (1491), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 278/419 (66%), Positives = 345/419 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELKN+  + L+   ESL +EN   +RKQ+++F+ILK  +    +I G+GV+E+LQD
Sbjct: 1   MNLTELKNRPVSDLVKLGESLGLENLARLRKQDIIFAILKAHAKGGEDIFGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGD++ G IR P++GERYFALLKVN +N
Sbjct: 61  GFGFLRSADSSYLAGPDDIYVSPSQIRHFNLRTGDSIAGKIRPPKDGERYFALLKVNTVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
            D P+  RNKI F+NLTPL+ ++R  ME  N   +DI++RV+DL +PIGKGQR LIVAPP
Sbjct: 121 DDKPDNARNKILFENLTPLHANERMVMERGNGSTEDITARVLDLASPIGKGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA SI  NHPEC L+VLLIDERPEEVT+MQR V+GEV++STFDE A+RHV
Sbjct: 181 KAGKTMLLQNIAQSIAYNHPECELMVLLIDERPEEVTEMQRLVKGEVVASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANAL RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVVPSSGKVLTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TALVDTGS+MDEVI+EEFKGTGN E+ L RKIA+KR+FPA+D 
Sbjct: 301 FGAARNVEEGGSLTIIATALVDTGSKMDEVIYEEFKGTGNMELHLNRKIAEKRVFPAIDF 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQ 422
            +SGTR+E+LL +  +LQK+++LR+IV  M   DA+EFLIDKL  TK N +FF +M +Q
Sbjct: 361 NRSGTRREELLTKTDELQKMWILRKIVHPMGEIDAMEFLIDKLAMTKTNDEFFDAMRRQ 419


>gi|120553418|ref|YP_957769.1| transcription termination factor Rho [Marinobacter aquaeolei VT8]
 gi|120323267|gb|ABM17582.1| transcription termination factor Rho [Marinobacter aquaeolei VT8]
          Length = 420

 Score =  578 bits (1490), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 276/420 (65%), Positives = 353/420 (84%), Gaps = 1/420 (0%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK KS  +LL  A+ + ++N    RKQ+++F+ILK  +    +I G+GV+E+LQD
Sbjct: 1   MNLTELKQKSVPELLDIAQEMGLDNLARSRKQDVIFTILKKHAKSGEDIYGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS DA+YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P++GERYFALLKVN IN
Sbjct: 61  GFGFLRSADASYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKDGERYFALLKVNEIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           FD P+  RNKI F+NLTPL+PD+R  +E  N   +D+SSRV+DL+APIGKGQR LIV+PP
Sbjct: 121 FDKPDNARNKILFENLTPLFPDERLTLEAGNGSTEDLSSRVLDLVAPIGKGQRGLIVSPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+L+Q+IA SI +N+PEC+++VLLIDERPEEVT+MQR+V+GEVI+STFDE  ARHV
Sbjct: 181 KAGKTLLMQSIAQSITRNNPECHVMVLLIDERPEEVTEMQRTVRGEVIASTFDEPPARHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDA+AL++PKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVIPSSGKVLTGGVDAHALEKPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTI+ TALV+TGS+MDEVI+EEFKGTGN EI L+RKIA+KR +PA++I
Sbjct: 301 FGAARNVEEGGSLTILATALVNTGSKMDEVIYEEFKGTGNMEIHLDRKIAEKRTYPAINI 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSM-NSSDAIEFLIDKLKQTKDNKDFFYSMNKQ 422
             SGTR+EDLL+   D+Q+V++LR+++ SM + + AIEFL+DKLK TK N +FF SM ++
Sbjct: 361 RSSGTRREDLLMSEADIQRVWILRKLLHSMDDDTAAIEFLLDKLKDTKTNDEFFQSMKRR 420


>gi|70733266|ref|YP_263039.1| transcription termination factor Rho [Pseudomonas fluorescens Pf-5]
 gi|68347565|gb|AAY95171.1| transcription termination factor Rho [Pseudomonas fluorescens Pf-5]
          Length = 419

 Score =  578 bits (1490), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 279/419 (66%), Positives = 347/419 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK K  T+LL  AE + IEN    RKQ+++FS+LK  +    EI G+GV+E+LQD
Sbjct: 1   MNLTELKQKPITELLELAEQMGIENMARSRKQDVIFSLLKKHAKSGEEISGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS DA+YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P+EGERYFALLKV+ IN
Sbjct: 61  GFGFLRSADASYLAGPDDIYVSPSQIRRFNLRTGDTIVGKIRPPKEGERYFALLKVDTIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           +D PE  +NKI F+NLTPL+P  R  ME  N   +D++ RVIDL APIGKGQR LIVAPP
Sbjct: 121 YDRPENAKNKILFENLTPLFPTVRMKMEAGNGSTEDLTGRVIDLCAPIGKGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKTI+LQNIA +I +N+PE +LIVLLIDERPEEVT+MQR+V+GEV++STFDE   RHV
Sbjct: 181 KAGKTIMLQNIASNITRNNPEVHLIVLLIDERPEEVTEMQRTVRGEVVASTFDEPPTRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDA+AL++PKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVIPSSGKVLTGGVDAHALEKPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TALV+TGS+MDEVI+EEFKGTGN E+ L+RKIA+KR+FPA++I
Sbjct: 301 FGAARNIEEGGSLTIIATALVETGSKMDEVIYEEFKGTGNMELPLDRKIAEKRVFPAINI 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQ 422
            +SGTR+E+LL    +LQ++++LR+++  M+   AIEFL+DKLKQTK N +FF SM ++
Sbjct: 361 NRSGTRREELLTADDELQRMWILRKLLHPMDEVAAIEFLVDKLKQTKTNDEFFLSMKRK 419


>gi|28899774|ref|NP_799379.1| transcription termination factor Rho [Vibrio parahaemolyticus RIMD
           2210633]
 gi|91228019|ref|ZP_01262104.1| transcription termination factor Rho [Vibrio alginolyticus 12G01]
 gi|260362507|ref|ZP_05775433.1| transcription termination factor Rho [Vibrio parahaemolyticus
           K5030]
 gi|260877187|ref|ZP_05889542.1| transcription termination factor Rho [Vibrio parahaemolyticus
           AN-5034]
 gi|260897231|ref|ZP_05905727.1| transcription termination factor Rho [Vibrio parahaemolyticus
           Peru-466]
 gi|260901363|ref|ZP_05909758.1| transcription termination factor Rho [Vibrio parahaemolyticus
           AQ4037]
 gi|262392872|ref|YP_003284726.1| transcription termination factor Rho [Vibrio sp. Ex25]
 gi|269964529|ref|ZP_06178768.1| transcription termination factor Rho [Vibrio alginolyticus 40B]
 gi|28808026|dbj|BAC61263.1| transcription termination factor Rho [Vibrio parahaemolyticus RIMD
           2210633]
 gi|91188248|gb|EAS74547.1| transcription termination factor Rho [Vibrio alginolyticus 12G01]
 gi|262336466|gb|ACY50261.1| transcription termination factor Rho [Vibrio sp. Ex25]
 gi|269830656|gb|EEZ84876.1| transcription termination factor Rho [Vibrio alginolyticus 40B]
 gi|308088933|gb|EFO38628.1| transcription termination factor Rho [Vibrio parahaemolyticus
           Peru-466]
 gi|308094130|gb|EFO43825.1| transcription termination factor Rho [Vibrio parahaemolyticus
           AN-5034]
 gi|308107172|gb|EFO44712.1| transcription termination factor Rho [Vibrio parahaemolyticus
           AQ4037]
 gi|308112669|gb|EFO50209.1| transcription termination factor Rho [Vibrio parahaemolyticus
           K5030]
          Length = 419

 Score =  578 bits (1490), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 278/419 (66%), Positives = 345/419 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELKN+  + L+   ESL +EN   +RKQ+++F+ILK  +    +I G+GV+E+LQD
Sbjct: 1   MNLTELKNRPVSDLVKLGESLGLENLARLRKQDIIFAILKAHAKGGEDIFGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGD++ G IR P++GERYFALLKVN +N
Sbjct: 61  GFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDSIAGKIRPPKDGERYFALLKVNTVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
            D P+  RNKI F+NLTPL+ ++R  ME  N   +DI++RV+DL +PIGKGQR LIVAPP
Sbjct: 121 DDKPDNARNKILFENLTPLHANERMVMERGNGSTEDITARVLDLASPIGKGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA SI  NHPEC L+VLLIDERPEEVT+MQR V+GEV++STFDE A+RHV
Sbjct: 181 KAGKTMLLQNIAQSIAYNHPECELMVLLIDERPEEVTEMQRLVKGEVVASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANAL RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVVPSSGKVLTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TALVDTGS+MDEVI+EEFKGTGN E+ L RKIA+KR+FPA+D 
Sbjct: 301 FGAARNVEEGGSLTIIATALVDTGSKMDEVIYEEFKGTGNMELHLNRKIAEKRVFPAIDF 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQ 422
            +SGTR+E+LL +  +LQK+++LR+IV  M   DA+EFLIDKL  TK N +FF +M +Q
Sbjct: 361 NRSGTRREELLTKTDELQKMWILRKIVHPMGEIDAMEFLIDKLAMTKTNDEFFDAMRRQ 419


>gi|15600432|ref|NP_253926.1| transcription termination factor Rho [Pseudomonas aeruginosa PAO1]
 gi|107104341|ref|ZP_01368259.1| hypothetical protein PaerPA_01005416 [Pseudomonas aeruginosa PACS2]
 gi|116053386|ref|YP_793711.1| transcription termination factor Rho [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|152988902|ref|YP_001351298.1| transcription termination factor Rho [Pseudomonas aeruginosa PA7]
 gi|218894341|ref|YP_002443211.1| transcription termination factor Rho [Pseudomonas aeruginosa
           LESB58]
 gi|254238064|ref|ZP_04931387.1| transcription termination factor Rho [Pseudomonas aeruginosa C3719]
 gi|254243879|ref|ZP_04937201.1| transcription termination factor Rho [Pseudomonas aeruginosa 2192]
 gi|296392097|ref|ZP_06881572.1| transcription termination factor Rho [Pseudomonas aeruginosa PAb1]
 gi|313110308|ref|ZP_07796200.1| transcription termination factor Rho [Pseudomonas aeruginosa 39016]
 gi|81856927|sp|Q9HTV1|RHO_PSEAE RecName: Full=Transcription termination factor Rho; AltName:
           Full=ATP-dependent helicase Rho
 gi|9951548|gb|AAG08624.1|AE004936_7 transcription termination factor Rho [Pseudomonas aeruginosa PAO1]
 gi|115588607|gb|ABJ14622.1| transcription termination factor Rho [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|126169995|gb|EAZ55506.1| transcription termination factor Rho [Pseudomonas aeruginosa C3719]
 gi|126197257|gb|EAZ61320.1| transcription termination factor Rho [Pseudomonas aeruginosa 2192]
 gi|150964060|gb|ABR86085.1| transcription termination factor Rho [Pseudomonas aeruginosa PA7]
 gi|218774570|emb|CAW30387.1| transcription termination factor Rho [Pseudomonas aeruginosa
           LESB58]
 gi|310882702|gb|EFQ41296.1| transcription termination factor Rho [Pseudomonas aeruginosa 39016]
          Length = 419

 Score =  578 bits (1490), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 276/419 (65%), Positives = 351/419 (83%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK K   +LL  ++++ +EN    RKQ+++F++LK  +    EI G+GV+E+LQD
Sbjct: 1   MNLTELKQKPIAELLEMSDAMGLENMARSRKQDIIFALLKKHAKSGEEISGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P+EGERYFALLKV++IN
Sbjct: 61  GFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTIIGKIRPPKEGERYFALLKVDSIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           FD PE  +NKI F+NLTPL+P++R  ME  N   +D++ RVIDL APIGKGQR LIVAPP
Sbjct: 121 FDRPENAKNKILFENLTPLFPNERMKMEAGNGSTEDLTGRVIDLCAPIGKGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKTI+LQNIA +I +N+PEC+LIVLLIDERPEEVT+MQR+V+GEV++STFDE   RHV
Sbjct: 181 KAGKTIMLQNIASNITRNNPECHLIVLLIDERPEEVTEMQRTVRGEVVASTFDEPPTRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDA+AL++PKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVIPSSGKVLTGGVDAHALEKPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTI+ TALV+TGS+MDEVI+EEFKGTGN E+ L+RKIA+KR+FPA++I
Sbjct: 301 FGAARNIEEGGSLTILATALVETGSKMDEVIYEEFKGTGNMELPLDRKIAEKRVFPAINI 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQ 422
            +SGTR+E+LL    +LQ++++LR+I+  M+   AIEFLIDKLKQTK N +FF SM ++
Sbjct: 361 NRSGTRREELLTSEDELQRMWILRKILHPMDEISAIEFLIDKLKQTKTNDEFFDSMKRK 419


>gi|237727906|ref|ZP_04558387.1| transcription termination factor Rho [Citrobacter sp. 30_2]
 gi|226910355|gb|EEH96273.1| transcription termination factor Rho [Citrobacter sp. 30_2]
          Length = 443

 Score =  578 bits (1490), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 273/418 (65%), Positives = 344/418 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELKN   ++L+   E++ +EN   MRKQ+++F+ILK  +    +I G+GV+E+LQD
Sbjct: 25  MNLTELKNTPVSELITLGENMGLENLARMRKQDIIFAILKQHAKSGEDIFGDGVLEILQD 84

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P+EGERYFALLKVN +N
Sbjct: 85  GFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNEVN 144

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           +D PE  RNKI F+NLTPL+ + R  ME  N   +D+++RV+DL +PIG+GQR LIVAPP
Sbjct: 145 YDKPENARNKILFENLTPLHANSRLRMERGNGSTEDLTARVLDLASPIGRGQRGLIVAPP 204

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA SI  NHP+C L+VLLIDERPEEVT+MQR V+GEV++STFDE A+RHV
Sbjct: 205 KAGKTMLLQNIAQSIAYNHPDCVLMVLLIDERPEEVTEMQRLVKGEVVASTFDEPASRHV 264

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DV+ILLDSITRL RAYN ++P+SGK+LTGGVDANAL RPKRF
Sbjct: 265 QVAEMVIEKAKRLVEHKKDVIILLDSITRLARAYNTVVPASGKVLTGGVDANALHRPKRF 324

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TAL+DTGS+MDEVI+EEFKGTGN E+ L RKIA+KR+FPA+D 
Sbjct: 325 FGAARNVEEGGSLTIIATALIDTGSKMDEVIYEEFKGTGNMELHLSRKIAEKRVFPAIDY 384

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            +SGTRKE+LL  +++LQK+++LR+I+  M   DA+EFLI+KL  TK N DFF  M +
Sbjct: 385 NRSGTRKEELLTTQEELQKMWILRKIIHPMGEIDAMEFLINKLAMTKTNDDFFDMMKR 442


>gi|94970256|ref|YP_592304.1| transcription termination factor Rho [Candidatus Koribacter
           versatilis Ellin345]
 gi|94552306|gb|ABF42230.1| transcription termination factor Rho [Candidatus Koribacter
           versatilis Ellin345]
          Length = 415

 Score =  578 bits (1490), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 276/417 (66%), Positives = 347/417 (83%), Gaps = 3/417 (0%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M + ELK K+ T+L   A SL++  A+ +RKQ+L+F IL+  S ++  I  EGV+E+L D
Sbjct: 1   MTIAELKEKNITELTRIARSLDLPGASGLRKQDLIFKILQAQSEKEGHIFAEGVLEILPD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           G+GFLRSPD NYL GPDDIYVSPSQI+ F LKTGDT+ G +R P EGE+YFAL+K+ A+N
Sbjct: 61  GYGFLRSPDYNYLPGPDDIYVSPSQIRKFDLKTGDTISGQVRPPHEGEKYFALVKIEAVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           F+ P+  RNKI FDNLTPLYP +R  +E       +IS+RV+DL+ P+GKGQR LIVAPP
Sbjct: 121 FESPDEARNKILFDNLTPLYPQERIKLET---VRDNISARVMDLLTPVGKGQRGLIVAPP 177

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           RTGKT+LLQN+A+SI  NHPE  LIVLLIDERPEEVTDMQRSV+GEVISSTFDE AARHV
Sbjct: 178 RTGKTMLLQNLANSITTNHPEIVLIVLLIDERPEEVTDMQRSVKGEVISSTFDEPAARHV 237

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++P SGK+L+GGVD+NALQRPKRF
Sbjct: 238 QVAEMVIEKAKRLVEHKRDVVILLDSITRLARAYNTIVPPSGKVLSGGVDSNALQRPKRF 297

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TAL++TGSRMD+VIFEEFKGTGN EI+L+RK+ADKR FPA+DI
Sbjct: 298 FGAARNIEEGGSLTIIATALIETGSRMDDVIFEEFKGTGNMEIILDRKLADKRTFPAIDI 357

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
            +SGTRKE+LL+ ++DLQ++++LRR+++ ++  +A+E LIDKL ++++N +F  +MN
Sbjct: 358 QRSGTRKEELLLAKEDLQRIWILRRVLNPLSPVEAMELLIDKLGKSRNNGEFLSNMN 414


>gi|157144415|ref|YP_001451734.1| transcription termination factor Rho [Citrobacter koseri ATCC
           BAA-895]
 gi|283787535|ref|YP_003367400.1| transcription termination factor [Citrobacter rodentium ICC168]
 gi|283834553|ref|ZP_06354294.1| transcription termination factor Rho [Citrobacter youngae ATCC
           29220]
 gi|311281532|ref|YP_003943763.1| transcription termination factor Rho [Enterobacter cloacae SCF1]
 gi|157081620|gb|ABV11298.1| hypothetical protein CKO_00124 [Citrobacter koseri ATCC BAA-895]
 gi|282950989|emb|CBG90666.1| transcription termination factor [Citrobacter rodentium ICC168]
 gi|291069683|gb|EFE07792.1| transcription termination factor Rho [Citrobacter youngae ATCC
           29220]
 gi|308750727|gb|ADO50479.1| transcription termination factor Rho [Enterobacter cloacae SCF1]
          Length = 419

 Score =  578 bits (1489), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 273/418 (65%), Positives = 344/418 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELKN   ++L+   E++ +EN   MRKQ+++F+ILK  +    +I G+GV+E+LQD
Sbjct: 1   MNLTELKNTPVSELITLGENMGLENLARMRKQDIIFAILKQHAKSGEDIFGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P+EGERYFALLKVN +N
Sbjct: 61  GFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNEVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           +D PE  RNKI F+NLTPL+ + R  ME  N   +D+++RV+DL +PIG+GQR LIVAPP
Sbjct: 121 YDKPENARNKILFENLTPLHANSRLRMERGNGSTEDLTARVLDLASPIGRGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA SI  NHP+C L+VLLIDERPEEVT+MQR V+GEV++STFDE A+RHV
Sbjct: 181 KAGKTMLLQNIAQSIAYNHPDCVLMVLLIDERPEEVTEMQRLVKGEVVASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DV+ILLDSITRL RAYN ++P+SGK+LTGGVDANAL RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVIILLDSITRLARAYNTVVPASGKVLTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TAL+DTGS+MDEVI+EEFKGTGN E+ L RKIA+KR+FPA+D 
Sbjct: 301 FGAARNVEEGGSLTIIATALIDTGSKMDEVIYEEFKGTGNMELHLSRKIAEKRVFPAIDY 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            +SGTRKE+LL  +++LQK+++LR+I+  M   DA+EFLI+KL  TK N DFF  M +
Sbjct: 361 NRSGTRKEELLTTQEELQKMWILRKIIHPMGEIDAMEFLINKLAMTKTNDDFFDMMKR 418


>gi|330957134|gb|EGH57394.1| transcription termination factor Rho [Pseudomonas syringae pv.
           maculicola str. ES4326]
          Length = 419

 Score =  578 bits (1489), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 281/419 (67%), Positives = 346/419 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK K  T+LL  AE   IEN    RKQ+++FS+LK  S    EI G+GV+E+LQD
Sbjct: 1   MNLTELKQKPITELLEMAEQAGIENMARSRKQDVIFSLLKRHSKSGEEISGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS DA+YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P+EGERYFALLKV+ IN
Sbjct: 61  GFGFLRSADASYLAGPDDIYVSPSQIRRFNLRTGDTIVGKIRPPKEGERYFALLKVDTIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           +D PE  +NKI F+NLTPL+P  R  ME  N   +D++ RVIDL APIGKGQR LIVAPP
Sbjct: 121 YDRPENAKNKILFENLTPLFPTIRMKMEAGNGSTEDLTGRVIDLCAPIGKGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKTI+LQNIA +I +N+PE +LIVLLIDERPEEVT+MQR+V+GEV++STFDE   RHV
Sbjct: 181 KAGKTIMLQNIASNITRNNPEVHLIVLLIDERPEEVTEMQRTVRGEVVASTFDEPPTRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDA+AL++PKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVIPSSGKVLTGGVDAHALEKPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TALV+TGS+MDEVI+EEFKGTGN E+ L+RKIA+KR+FPA++I
Sbjct: 301 FGAARNIEEGGSLTIIATALVETGSKMDEVIYEEFKGTGNMELPLDRKIAEKRVFPAINI 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQ 422
            +SGTR+E+LL    +LQ++++LR+++  M+   AIEFLIDKLKQTK N +FF SM ++
Sbjct: 361 NRSGTRREELLTADDELQRMWILRKLLHPMDEVAAIEFLIDKLKQTKTNDEFFLSMKRK 419


>gi|197120074|ref|YP_002140501.1| transcription termination factor Rho [Geobacter bemidjiensis Bem]
 gi|197089434|gb|ACH40705.1| transcription termination factor Rho [Geobacter bemidjiensis Bem]
          Length = 415

 Score =  578 bits (1489), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 281/418 (67%), Positives = 343/418 (82%), Gaps = 3/418 (0%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M LQELK K    L A A+ L IE A+ +RKQ+L+F+IL   + ++  I GEGV+E L D
Sbjct: 1   MNLQELKEKKINDLTAIAKGLNIEGASSLRKQDLIFAILNAQTEKNGMIFGEGVLETLPD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLR+PD NYL GPDDIYVSPSQI+ F+L TGDTV G IR P+EGERYFALLKV  +N
Sbjct: 61  GFGFLRAPDYNYLPGPDDIYVSPSQIRRFNLHTGDTVAGQIRPPKEGERYFALLKVETVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
            + PE  R+KI FDNLTPLYP ++  +E  +    ++S+RV++LIAPIGKGQR LIVAPP
Sbjct: 121 HESPEVARDKILFDNLTPLYPQEKLKLETTH---DNMSTRVMELIAPIGKGQRGLIVAPP 177

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           RTGKT+L+QNIA+SI  NHPE +LIVLLIDERPEEVTDMQRSV+GEVISSTFDE A+RH+
Sbjct: 178 RTGKTMLIQNIANSIAMNHPEVFLIVLLIDERPEEVTDMQRSVKGEVISSTFDEPASRHI 237

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++P SGKIL+GGVD+NAL +PKRF
Sbjct: 238 QVAEMVIEKAKRLVEHKRDVVILLDSITRLARAYNTVIPPSGKILSGGVDSNALHKPKRF 297

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TALVDTGS+MDEVIFEEFKGTGN E+ L+RK+ +KR FPA+DI
Sbjct: 298 FGAARNIEEGGSLTIIATALVDTGSKMDEVIFEEFKGTGNMELHLDRKLVEKRTFPAIDI 357

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            KSGTRKE+LL+++  L ++++LR+++  MN  D++EFLI KL+ TK N+DF  SM+K
Sbjct: 358 NKSGTRKEELLIDKASLNRIWILRKVLHPMNVVDSMEFLISKLQGTKSNQDFLDSMSK 415


>gi|242237662|ref|YP_002985843.1| transcription termination factor Rho [Dickeya dadantii Ech703]
 gi|242129719|gb|ACS84021.1| transcription termination factor Rho [Dickeya dadantii Ech703]
          Length = 419

 Score =  578 bits (1489), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 273/418 (65%), Positives = 344/418 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELKN   ++L+   E++ +EN   MRKQ+++F+ILK  +    +I G+GV+E+LQD
Sbjct: 1   MNLTELKNTPVSELITLGENMGLENLARMRKQDIIFAILKQHAKSGEDIFGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P+EGERYFALLKVN +N
Sbjct: 61  GFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNEVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           +D PE  RNKI F+NLTPL+ + R  ME  N   +D+++RV+DL APIG+GQR LIVAPP
Sbjct: 121 YDKPENARNKILFENLTPLHANSRLRMERGNGSTEDLTARVLDLAAPIGRGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA SI  NHP+C L+VLLIDERPEEVT+MQR V+GEV++STFDE A+RHV
Sbjct: 181 KAGKTMLLQNIAQSIAYNHPDCVLMVLLIDERPEEVTEMQRLVKGEVVASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DV+ILLDSITRL RAYN ++P+SGK+LTGGVDANAL RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVIILLDSITRLARAYNTVVPASGKVLTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TAL+DTGS+MDEVI+EEFKGTGN E+ L RKIA+KR+FPA+D 
Sbjct: 301 FGAARNVEEGGSLTIIATALIDTGSKMDEVIYEEFKGTGNMELHLSRKIAEKRVFPAIDY 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            +SGTRKE+LL  +++LQK+++LR+I+  M   DA+EFLI+KL  TK N +FF  M +
Sbjct: 361 NRSGTRKEELLTTQEELQKMWILRKIIHPMGEIDAMEFLINKLAMTKTNDEFFDMMKR 418


>gi|146313635|ref|YP_001178709.1| transcription termination factor Rho [Enterobacter sp. 638]
 gi|145320511|gb|ABP62658.1| transcription termination factor Rho [Enterobacter sp. 638]
          Length = 419

 Score =  578 bits (1489), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 275/418 (65%), Positives = 344/418 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELKN   ++L+   E++ +EN   MRKQ+++F+ILK  +    +I G+GV+E+LQD
Sbjct: 1   MNLTELKNTPVSELITLGENMGLENQARMRKQDIIFAILKQHAKSGEDIFGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P+EGERYFALLKVN +N
Sbjct: 61  GFGFLRSGDSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNEVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           +D PE  RNKI F+NLTPL+ + R  ME  N   +D+++RV+DL +PIG+GQR LIVAPP
Sbjct: 121 YDKPENSRNKILFENLTPLHANSRLRMERGNGSTEDLTARVLDLASPIGRGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA SI  NHP+C L+VLLIDERPEEVT+MQR V+GEVI+STFDE A+RHV
Sbjct: 181 KAGKTMLLQNIAQSIAYNHPDCVLMVLLIDERPEEVTEMQRLVKGEVIASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DV+ILLDSITRL RAYN ++P+SGK+LTGGVDANAL RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVIILLDSITRLARAYNTVVPASGKVLTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TALVDTGS+MDEVI+EEFKGTGN E+ L RKIA+KR+FPA+D 
Sbjct: 301 FGAARNVEEGGSLTIIATALVDTGSKMDEVIYEEFKGTGNMELHLARKIAEKRVFPAIDY 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            +SGTRKE+LL  +++LQK+++LR+I+  M   DA+EFLI+KL  TK N DFF  M +
Sbjct: 361 NRSGTRKEELLTTQEELQKMWILRKIIHPMGEIDAMEFLINKLAMTKTNDDFFDMMKR 418


>gi|156935887|ref|YP_001439803.1| transcription termination factor Rho [Cronobacter sakazakii ATCC
           BAA-894]
 gi|260596011|ref|YP_003208582.1| transcription termination factor Rho [Cronobacter turicensis z3032]
 gi|156534141|gb|ABU78967.1| hypothetical protein ESA_03775 [Cronobacter sakazakii ATCC BAA-894]
 gi|260215188|emb|CBA27021.1| Transcription termination factor rho [Cronobacter turicensis z3032]
          Length = 419

 Score =  577 bits (1488), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 273/418 (65%), Positives = 344/418 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELKN   ++L+   E++ +EN   MRKQ+++F+ILK  +    +I G+GV+E+LQD
Sbjct: 1   MNLTELKNTPVSELITLGENMGLENLARMRKQDIIFAILKQHAKSGEDIFGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P+EGERYFALLKVN +N
Sbjct: 61  GFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNEVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           FD PE  RNKI F+NLTPL+ + R  ME  N   +D+++RV+DL +PIG+GQR LIVAPP
Sbjct: 121 FDKPENARNKILFENLTPLHANSRLRMERGNGSTEDLTARVLDLASPIGRGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA SI  NHP+C L+VLLIDERPEEVT+MQR V+GEV++STFDE A+RHV
Sbjct: 181 KAGKTMLLQNIAQSIAYNHPDCVLMVLLIDERPEEVTEMQRLVKGEVVASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DV+ILLDSITRL RAYN ++P+SGK+LTGGVDANAL RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVIILLDSITRLARAYNTVVPASGKVLTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TAL+DTGS+MDEVI+EEFKGTGN E+ L RKIA+KR+FPA+D 
Sbjct: 301 FGAARNVEEGGSLTIIATALIDTGSKMDEVIYEEFKGTGNMELHLSRKIAEKRVFPAIDY 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            +SGTRKE+LL  +++LQK+++LR+I+  M   DA+EFLI+KL  TK N +FF  M +
Sbjct: 361 NRSGTRKEELLTTQEELQKMWILRKIIHPMGEIDAMEFLINKLAMTKTNDEFFDMMKR 418


>gi|261345268|ref|ZP_05972912.1| transcription termination factor Rho [Providencia rustigianii DSM
           4541]
 gi|282566966|gb|EFB72501.1| transcription termination factor Rho [Providencia rustigianii DSM
           4541]
          Length = 419

 Score =  577 bits (1488), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 277/418 (66%), Positives = 343/418 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELKN   ++L+   E++ +EN   MRKQ+++FSILK  +    +I G+GV+E+LQD
Sbjct: 1   MNLTELKNTPVSELITLGENMGLENLARMRKQDIIFSILKQHAKSGEDIFGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P+EGERYFALLKVN +N
Sbjct: 61  GFGFLRSGDSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNEVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           FD PE  RNKI F+NLTPL+ + R  ME  N   +D+++RV+DL APIG+GQR LIVAPP
Sbjct: 121 FDKPENARNKILFENLTPLHANNRLRMERGNGSTEDLTARVLDLAAPIGRGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA +I  N+P+C L+VLLIDERPEEVT+MQR V+GEVI+STFDE AARHV
Sbjct: 181 KAGKTMLLQNIAANIAHNYPDCVLMVLLIDERPEEVTEMQRLVKGEVIASTFDEPAARHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DV+ILLDSITRL RAYN ++PSSGK+LTGGVDANAL RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVIILLDSITRLARAYNTVVPSSGKVLTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TALVDTGS+MDEVI+EEFKGTGN E+ L RKIA+KR+FPA+D 
Sbjct: 301 FGAARNVEEGGSLTIIATALVDTGSKMDEVIYEEFKGTGNMELHLSRKIAEKRVFPAIDY 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            +SGTRKE+LL  + +LQK+++LR+I+  M   DA+EFLI KL  TK N++FF  M +
Sbjct: 361 NRSGTRKEELLTSQDELQKMWILRKIIHPMGEIDAMEFLISKLAMTKTNEEFFDFMKR 418


>gi|253690372|ref|YP_003019562.1| transcription termination factor Rho [Pectobacterium carotovorum
           subsp. carotovorum PC1]
 gi|251756950|gb|ACT15026.1| transcription termination factor Rho [Pectobacterium carotovorum
           subsp. carotovorum PC1]
          Length = 450

 Score =  577 bits (1488), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 274/420 (65%), Positives = 345/420 (82%)

Query: 2   SEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVL 61
           + M L ELKN   ++L+A  E++ +EN   MRKQ+++F+ILK  +    +I G+GV+E+L
Sbjct: 30  TTMNLTELKNTPVSELIALGENMGLENQARMRKQDIIFAILKQHAKSGEDIFGDGVLEIL 89

Query: 62  QDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNA 121
           QDGFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P+EGERYFALLKVN 
Sbjct: 90  QDGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNE 149

Query: 122 INFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVA 181
           +N+D PE  RNKI F+NLTPL+ + R  ME  N   +D+++RV+DL +PIG+GQR LIVA
Sbjct: 150 VNYDKPENARNKILFENLTPLHANSRLRMERGNGSTEDLTARVLDLASPIGRGQRGLIVA 209

Query: 182 PPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAAR 241
           PP+ GKT+LLQNIA SI  NHP+C L+VLLIDERPEEVT+MQR V+GEV++STFDE A+R
Sbjct: 210 PPKAGKTMLLQNIAQSIAYNHPDCVLMVLLIDERPEEVTEMQRLVKGEVVASTFDEPASR 269

Query: 242 HVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPK 301
           HVQVAEMVI KAK LVE+  DV+ILLDSITRL RAYN ++P+SGK+LTGGVDANAL RPK
Sbjct: 270 HVQVAEMVIEKAKRLVEHKKDVIILLDSITRLARAYNTVVPASGKVLTGGVDANALHRPK 329

Query: 302 RFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAM 361
           RFFGAARN++EGGSLTII TALVDTGS+MDEVI+EEFKGTGN E+ L RKIA+KR+FPA+
Sbjct: 330 RFFGAARNVEEGGSLTIIATALVDTGSKMDEVIYEEFKGTGNMELHLARKIAEKRVFPAI 389

Query: 362 DIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
           D  +SGTRKE+LL   ++LQK+++LR+I+  M   DA+EFLI+KL  TK N +FF  M +
Sbjct: 390 DYNRSGTRKEELLTTSEELQKMWILRKIIHPMGEIDAMEFLINKLAMTKTNDEFFDMMKR 449


>gi|291615699|ref|YP_003518441.1| Rho [Pantoea ananatis LMG 20103]
 gi|291150729|gb|ADD75313.1| Rho [Pantoea ananatis LMG 20103]
 gi|327395964|dbj|BAK13386.1| transcription termination factor Rho [Pantoea ananatis AJ13355]
          Length = 419

 Score =  577 bits (1488), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 275/418 (65%), Positives = 344/418 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELKN   ++L+   E++ +EN   MRKQ+++FSILK  +    +I G+GV+E+LQD
Sbjct: 1   MNLTELKNTPVSELITLGENMGLENQARMRKQDIIFSILKQHAKSGEDIFGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P+EGERYFALLKVN +N
Sbjct: 61  GFGFLRSGDSSYLAGPDDIYVSPSQIRRFNLRTGDTIAGKIRPPKEGERYFALLKVNEVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           +D PE  RNKI F+NLTPL+ + R  ME  N   +D+++RV+DL +PIG+GQR LIVAPP
Sbjct: 121 YDKPENSRNKILFENLTPLHANSRLRMERGNGSTEDLTARVLDLASPIGRGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA SI  NHP+C L+VLLIDERPEEVT+MQR V+GEVI+STFDE A+RHV
Sbjct: 181 KAGKTMLLQNIAQSIAYNHPDCVLMVLLIDERPEEVTEMQRLVKGEVIASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DV+ILLDSITRL RAYN ++P+SGK+LTGGVDANAL RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVIILLDSITRLARAYNTVVPASGKVLTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TALVDTGS+MDEVI+EEFKGTGN E+ L RKIA+KR+FPA+D 
Sbjct: 301 FGAARNVEEGGSLTIIATALVDTGSKMDEVIYEEFKGTGNMELHLSRKIAEKRVFPAIDY 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            +SGTRKE+LL  +++LQK+++LR+I+  M   DA+EFLI+KL  TK N +FF  M +
Sbjct: 361 NRSGTRKEELLTSQEELQKMWILRKIIHPMGEIDAMEFLINKLAMTKTNDEFFDMMKR 418


>gi|146280938|ref|YP_001171091.1| transcription termination factor Rho [Pseudomonas stutzeri A1501]
 gi|145569143|gb|ABP78249.1| transcription termination factor Rho [Pseudomonas stutzeri A1501]
 gi|327479208|gb|AEA82518.1| transcription termination factor Rho [Pseudomonas stutzeri DSM
           4166]
          Length = 419

 Score =  577 bits (1488), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 275/419 (65%), Positives = 350/419 (83%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK K  T+LL  AE + I+N    RKQ+++FS+LK  +    EI G+GV+E+LQD
Sbjct: 1   MNLTELKQKPITELLEMAEQMGIDNMARSRKQDVIFSLLKKHAKSGEEISGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P+EGERYFALLKV++IN
Sbjct: 61  GFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTIVGKIRPPKEGERYFALLKVDSIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           +D PE  +NKI F+NLTPL+P++R  ME  N   +D++ RVIDL APIGKGQR LIVAPP
Sbjct: 121 YDRPENAKNKILFENLTPLFPNERLKMEAGNGSTEDLTGRVIDLCAPIGKGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKTI+LQNIA +I +N+PEC+LIVLLIDERPEEVT+MQR+V+GEV++STFDE   RHV
Sbjct: 181 KAGKTIMLQNIASNITRNNPECHLIVLLIDERPEEVTEMQRTVRGEVVASTFDEPPTRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDA+AL++PKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVIPSSGKVLTGGVDAHALEKPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTI+ TALV+TGS+MDEVI+EEFKGTGN E+ L+R+IA+KR+FPA++I
Sbjct: 301 FGAARNIEEGGSLTILATALVETGSKMDEVIYEEFKGTGNLELQLDRRIAEKRVFPAINI 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQ 422
            +SGTR+E+LL    +LQ++++LR+++  M+   AIEFL+DKLK TK N +FF SM ++
Sbjct: 361 NRSGTRREELLTAEDELQRIWILRKLLHPMDEIAAIEFLLDKLKDTKTNDEFFMSMKRK 419


>gi|195940644|ref|ZP_03086026.1| transcription termination factor Rho [Escherichia coli O157:H7 str.
           EC4024]
 gi|261343047|ref|ZP_05970905.1| transcription termination factor Rho [Enterobacter cancerogenus
           ATCC 35316]
 gi|296105327|ref|YP_003615473.1| transcription termination factor Rho [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
 gi|288314612|gb|EFC53550.1| transcription termination factor Rho [Enterobacter cancerogenus
           ATCC 35316]
 gi|295059786|gb|ADF64524.1| transcription termination factor Rho [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
 gi|295095194|emb|CBK84284.1| transcription termination factor Rho [Enterobacter cloacae subsp.
           cloacae NCTC 9394]
          Length = 419

 Score =  577 bits (1488), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 273/418 (65%), Positives = 344/418 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELKN   ++L+   E++ +EN   MRKQ+++F+ILK  +    +I G+GV+E+LQD
Sbjct: 1   MNLTELKNTPVSELITLGENMGLENQARMRKQDIIFAILKQHAKSGEDIFGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P+EGERYFALLKVN +N
Sbjct: 61  GFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNEVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           +D PE  RNKI F+NLTPL+ + R  ME  N   +D+++RV+DL +PIG+GQR LIVAPP
Sbjct: 121 YDKPENSRNKILFENLTPLHANSRLRMERGNGSTEDLTARVLDLASPIGRGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA SI  NHP+C L+VLLIDERPEEVT+MQR V+GEV++STFDE A+RHV
Sbjct: 181 KAGKTMLLQNIAQSIAYNHPDCVLMVLLIDERPEEVTEMQRLVKGEVVASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DV+ILLDSITRL RAYN ++P+SGK+LTGGVDANAL RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVIILLDSITRLARAYNTVVPASGKVLTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TAL+DTGS+MDEVI+EEFKGTGN E+ L RKIA+KR+FPA+D 
Sbjct: 301 FGAARNVEEGGSLTIIATALIDTGSKMDEVIYEEFKGTGNMELHLSRKIAEKRVFPAIDY 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            +SGTRKE+LL  +++LQK+++LR+I+  M   DA+EFLI+KL  TK N DFF  M +
Sbjct: 361 NRSGTRKEELLTTQEELQKMWILRKIIHPMGEIDAMEFLINKLAMTKTNDDFFDMMKR 418


>gi|322834949|ref|YP_004214976.1| transcription termination factor Rho [Rahnella sp. Y9602]
 gi|321170150|gb|ADW75849.1| transcription termination factor Rho [Rahnella sp. Y9602]
          Length = 419

 Score =  577 bits (1488), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 276/418 (66%), Positives = 343/418 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELKN   + L+A  E++ +EN   MRKQ+++FSILK  +    +I G+GV+E+LQD
Sbjct: 1   MNLTELKNTPVSDLIALGENMGLENQARMRKQDIIFSILKQHAKSGEDIFGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P+EGERYFALLKVN +N
Sbjct: 61  GFGFLRSGDSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNEVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           +D PE  R+KI F+NLTPL+ + R  ME  N   +D+++RV+DL +PIG+GQR LIVAPP
Sbjct: 121 YDKPENARSKILFENLTPLHANSRLRMERGNGSTEDLTARVLDLASPIGRGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA SI  NHP+C L+VLLIDERPEEVT+MQR V+GEVI+STFDE A+RHV
Sbjct: 181 KAGKTMLLQNIATSIAYNHPDCVLMVLLIDERPEEVTEMQRLVKGEVIASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DV+ILLDSITRL RAYN ++P+SGK+LTGGVDANAL RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVIILLDSITRLARAYNTVVPASGKVLTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TALVDTGS+MDEVI+EEFKGTGN E+ L RKIA+KR+FPA+D 
Sbjct: 301 FGAARNVEEGGSLTIIATALVDTGSKMDEVIYEEFKGTGNMELHLARKIAEKRVFPAIDY 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            +SGTRKE+LL   ++LQK+++LR+I+  M   DA+EFLI+KL  TK N DFF  M +
Sbjct: 361 NRSGTRKEELLTTSEELQKMWILRKIIHPMGEIDAMEFLINKLAMTKTNDDFFDMMKR 418


>gi|37528480|ref|NP_931825.1| transcription termination factor Rho [Photorhabdus luminescens
           subsp. laumondii TTO1]
 gi|36787918|emb|CAE17035.1| transcription termination factor [Photorhabdus luminescens subsp.
           laumondii TTO1]
          Length = 419

 Score =  577 bits (1487), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 275/418 (65%), Positives = 343/418 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELKN   ++L+   E++ +EN   MRKQ+++FSILK  +    +I G+GV+E+LQD
Sbjct: 1   MNLTELKNTPVSELITLGENMGLENLARMRKQDIIFSILKQHAKSGEDIFGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P+EGERYFALLKVN +N
Sbjct: 61  GFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNEVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           FD PE  R+KI F+NLTPL+ + R  ME  N   +D+++RV+DL APIG+GQR LIVAPP
Sbjct: 121 FDKPENARSKILFENLTPLHANSRLRMERGNGSTEDLTARVLDLAAPIGRGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA +I  NHP+C L+VLLIDERPEEVT+MQR V+GEVI+STFDE A+RHV
Sbjct: 181 KAGKTMLLQNIAANIAHNHPDCVLMVLLIDERPEEVTEMQRLVKGEVIASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DV+ILLDSITRL RAYN ++P+SGK+LTGGVDANAL RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVIILLDSITRLARAYNTVVPASGKVLTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TALVDTGS+MDEVI+EEFKGTGN E+ L RKIA+KR+FPA+D 
Sbjct: 301 FGAARNVEEGGSLTIIATALVDTGSKMDEVIYEEFKGTGNMELHLSRKIAEKRVFPAIDY 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            +SGTRKE+LL   ++LQK+++LR+I+  M   DA+EFLI+KL  +K N DFF  M +
Sbjct: 361 NRSGTRKEELLTTSEELQKMWILRKIIHPMGEIDAMEFLINKLAMSKTNDDFFDMMKR 418


>gi|290477134|ref|YP_003470049.1| transcription termination factor Rho; polarity suppressor
           [Xenorhabdus bovienii SS-2004]
 gi|289176482|emb|CBJ83291.1| transcription termination factor Rho; polarity suppressor
           [Xenorhabdus bovienii SS-2004]
          Length = 419

 Score =  577 bits (1486), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 275/418 (65%), Positives = 345/418 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELKN   ++L+   E++ +EN   MRKQ+++FSILK  +    +I G+GV+E+LQD
Sbjct: 1   MNLTELKNTPVSELITLGENMGLENLARMRKQDIIFSILKQHAKSGEDIFGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P+EGERYFALLKVN +N
Sbjct: 61  GFGFLRSGDSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNEVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           FD PE  RNKI F+NLTPL+ + R  ME  N   +D+++RV+DL APIG+GQR LIVAPP
Sbjct: 121 FDKPENARNKILFENLTPLHANNRLRMERGNGSTEDLTARVLDLAAPIGRGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA +I  N+P+C L+VLLIDERPEEVT+MQR V+GEVI+STFDE A+RHV
Sbjct: 181 KAGKTMLLQNIAANIANNYPDCVLMVLLIDERPEEVTEMQRLVKGEVIASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DV+ILLDSITRL RAYN ++P+SGK+LTGGVDANAL RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVIILLDSITRLARAYNTVVPASGKVLTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TALVDTGS+MDEVI+EEFKGTGN E+ L RKIA+KR+FPA+D 
Sbjct: 301 FGAARNVEEGGSLTIIATALVDTGSKMDEVIYEEFKGTGNMELHLSRKIAEKRVFPAIDY 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            +SGTRKE+LL  + +LQK+++LR+I+  M  +DA+EFLI+KL  TK N++FF  M +
Sbjct: 361 NRSGTRKEELLTTQDELQKMWILRKIIHPMGEADAMEFLINKLAMTKTNEEFFDFMKR 418


>gi|28872354|ref|NP_794973.1| transcription termination factor Rho [Pseudomonas syringae pv.
           tomato str. DC3000]
 gi|66043571|ref|YP_233412.1| transcription termination factor Rho [Pseudomonas syringae pv.
           syringae B728a]
 gi|71734599|ref|YP_272593.1| transcription termination factor Rho [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|213971839|ref|ZP_03399941.1| transcription termination factor Rho [Pseudomonas syringae pv.
           tomato T1]
 gi|237797987|ref|ZP_04586448.1| transcription termination factor Rho [Pseudomonas syringae pv.
           oryzae str. 1_6]
 gi|257481843|ref|ZP_05635884.1| transcription termination factor Rho [Pseudomonas syringae pv.
           tabaci ATCC 11528]
 gi|289624462|ref|ZP_06457416.1| transcription termination factor Rho [Pseudomonas syringae pv.
           aesculi str. NCPPB3681]
 gi|289651577|ref|ZP_06482920.1| transcription termination factor Rho [Pseudomonas syringae pv.
           aesculi str. 2250]
 gi|289674521|ref|ZP_06495411.1| transcription termination factor Rho [Pseudomonas syringae pv.
           syringae FF5]
 gi|298485180|ref|ZP_07003274.1| Transcription termination factor Rho [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|301383376|ref|ZP_07231794.1| transcription termination factor Rho [Pseudomonas syringae pv.
           tomato Max13]
 gi|302064069|ref|ZP_07255610.1| transcription termination factor Rho [Pseudomonas syringae pv.
           tomato K40]
 gi|302134963|ref|ZP_07260953.1| transcription termination factor Rho [Pseudomonas syringae pv.
           tomato NCPPB 1108]
 gi|302186813|ref|ZP_07263486.1| transcription termination factor Rho [Pseudomonas syringae pv.
           syringae 642]
 gi|28855609|gb|AAO58668.1| transcription termination factor Rho [Pseudomonas syringae pv.
           tomato str. DC3000]
 gi|63254278|gb|AAY35374.1| Transcription termination factor Rho [Pseudomonas syringae pv.
           syringae B728a]
 gi|71555152|gb|AAZ34363.1| transcription termination factor Rho [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|213923385|gb|EEB56978.1| transcription termination factor Rho [Pseudomonas syringae pv.
           tomato T1]
 gi|298160292|gb|EFI01319.1| Transcription termination factor Rho [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|320322167|gb|EFW78263.1| transcription termination factor Rho [Pseudomonas syringae pv.
           glycinea str. B076]
 gi|320331818|gb|EFW87756.1| transcription termination factor Rho [Pseudomonas syringae pv.
           glycinea str. race 4]
 gi|330866612|gb|EGH01321.1| transcription termination factor Rho [Pseudomonas syringae pv.
           aesculi str. 0893_23]
 gi|330874078|gb|EGH08227.1| transcription termination factor Rho [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
 gi|330886069|gb|EGH19970.1| transcription termination factor Rho [Pseudomonas syringae pv. mori
           str. 301020]
 gi|330938789|gb|EGH42317.1| transcription termination factor Rho [Pseudomonas syringae pv. pisi
           str. 1704B]
 gi|330971841|gb|EGH71907.1| transcription termination factor Rho [Pseudomonas syringae pv.
           aceris str. M302273PT]
 gi|330977252|gb|EGH77208.1| transcription termination factor Rho [Pseudomonas syringae pv.
           aptata str. DSM 50252]
 gi|330986780|gb|EGH84883.1| transcription termination factor Rho [Pseudomonas syringae pv.
           lachrymans str. M301315]
 gi|331009478|gb|EGH89534.1| transcription termination factor Rho [Pseudomonas syringae pv.
           tabaci ATCC 11528]
 gi|331017856|gb|EGH97912.1| transcription termination factor Rho [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
 gi|331020838|gb|EGI00895.1| transcription termination factor Rho [Pseudomonas syringae pv.
           oryzae str. 1_6]
          Length = 419

 Score =  577 bits (1486), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 280/419 (66%), Positives = 346/419 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK K  T+LL  AE   IEN    RKQ+++FS+LK  +    EI G+GV+E+LQD
Sbjct: 1   MNLTELKQKPITELLEMAEQAGIENMARSRKQDVIFSLLKRHAKSGEEISGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS DA+YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P+EGERYFALLKV+ IN
Sbjct: 61  GFGFLRSADASYLAGPDDIYVSPSQIRRFNLRTGDTIVGKIRPPKEGERYFALLKVDTIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           +D PE  +NKI F+NLTPL+P  R  ME  N   +D++ RVIDL APIGKGQR LIVAPP
Sbjct: 121 YDRPENAKNKILFENLTPLFPTIRMKMEAGNGSTEDLTGRVIDLCAPIGKGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKTI+LQNIA +I +N+PE +LIVLLIDERPEEVT+MQR+V+GEV++STFDE   RHV
Sbjct: 181 KAGKTIMLQNIASNITRNNPEVHLIVLLIDERPEEVTEMQRTVRGEVVASTFDEPPTRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDA+AL++PKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVIPSSGKVLTGGVDAHALEKPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TALV+TGS+MDEVI+EEFKGTGN E+ L+RKIA+KR+FPA++I
Sbjct: 301 FGAARNIEEGGSLTIIATALVETGSKMDEVIYEEFKGTGNMELPLDRKIAEKRVFPAINI 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQ 422
            +SGTR+E+LL    +LQ++++LR+++  M+   AIEFLIDKLKQTK N +FF SM ++
Sbjct: 361 NRSGTRREELLTADDELQRMWILRKLLHPMDEVAAIEFLIDKLKQTKTNDEFFLSMKRK 419


>gi|253991616|ref|YP_003042972.1| transcription termination factor Rho [Photorhabdus asymbiotica
           subsp. asymbiotica ATCC 43949]
 gi|253783066|emb|CAQ86231.1| transcription termination factor [Photorhabdus asymbiotica]
          Length = 419

 Score =  577 bits (1486), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 275/418 (65%), Positives = 343/418 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELKN   ++L+   E++ +EN   MRKQ+++FSILK  +    +I G+GV+E+LQD
Sbjct: 1   MNLTELKNTPVSELITLGENMGLENLARMRKQDIIFSILKQHAKSGEDIFGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P+EGERYFALLKVN +N
Sbjct: 61  GFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNEVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           FD PE  R+KI F+NLTPL+ + R  ME  N   +D+++RV+DL APIG+GQR LIVAPP
Sbjct: 121 FDKPENARSKILFENLTPLHANNRLRMERGNGSTEDLTARVLDLAAPIGRGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA +I  NHP+C L+VLLIDERPEEVT+MQR V+GEVI+STFDE A+RHV
Sbjct: 181 KAGKTMLLQNIAANIAHNHPDCVLMVLLIDERPEEVTEMQRLVKGEVIASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DV+ILLDSITRL RAYN ++P+SGK+LTGGVDANAL RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVIILLDSITRLARAYNTVVPASGKVLTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TALVDTGS+MDEVI+EEFKGTGN E+ L RKIA+KR+FPA+D 
Sbjct: 301 FGAARNVEEGGSLTIIATALVDTGSKMDEVIYEEFKGTGNMELHLSRKIAEKRVFPAIDY 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            +SGTRKE+LL   ++LQK+++LR+I+  M   DA+EFLI+KL  +K N DFF  M +
Sbjct: 361 NRSGTRKEELLTTSEELQKMWILRKIIHPMGEIDAMEFLINKLAMSKTNDDFFDMMKR 418


>gi|304309756|ref|YP_003809354.1| Transcription termination factor Rho [gamma proteobacterium HdN1]
 gi|301795489|emb|CBL43687.1| Transcription termination factor Rho [gamma proteobacterium HdN1]
          Length = 419

 Score =  577 bits (1486), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 273/419 (65%), Positives = 345/419 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK K    L+  AE + +EN    RKQ+++F+ILK  +    +I G+GV+E+LQD
Sbjct: 1   MNLTELKQKPVADLVHMAEEMGLENIARTRKQDIIFAILKRHAKGGEDIYGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS + +YLAGPDDIYVSPSQ++ F+L+TGDT+ G IR P+EGERYFALLKVN IN
Sbjct: 61  GFGFLRSSEGSYLAGPDDIYVSPSQVRRFNLRTGDTISGKIRPPKEGERYFALLKVNDIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           +DVP   +NK+ F+NLTPL+P +R   EL N   +DI++RVIDL+AP GKGQR LI+APP
Sbjct: 121 YDVPASTKNKVLFENLTPLFPQQRLKAELGNGSTEDITARVIDLVAPFGKGQRGLIIAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT++LQNIAHSI +N+PEC LIVLLIDERPEEVTDM+RSV+ EV++STFDE   RHV
Sbjct: 181 KAGKTMMLQNIAHSISRNNPECILIVLLIDERPEEVTDMRRSVRAEVVASTFDEPPTRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMV+ KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANAL+RPKRF
Sbjct: 241 QVAEMVLEKAKRLVEHKKDVVILLDSITRLARAYNTVIPSSGKVLTGGVDANALERPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTI+ TALVDTGS+MDEVI+EEFKGTGN EI L+R++++KR+FPA++I
Sbjct: 301 FGAARNIEEGGSLTILATALVDTGSKMDEVIYEEFKGTGNMEIHLDRRVSEKRVFPAINI 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQ 422
            KSGTR+EDLL    +L+K+++LR+I+  M+   AIEFLIDK++ TK N +FF SM ++
Sbjct: 361 NKSGTRREDLLTSEDELKKMWILRKILHPMDEISAIEFLIDKMRDTKTNDEFFDSMKRK 419


>gi|77461677|ref|YP_351184.1| transcription termination factor Rho [Pseudomonas fluorescens
           Pf0-1]
 gi|77385680|gb|ABA77193.1| transcription termination factor [Pseudomonas fluorescens Pf0-1]
          Length = 419

 Score =  576 bits (1485), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 279/419 (66%), Positives = 346/419 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK K  T+LL  AE + IEN    RKQ+++FS+LK  +    EI G+GV+E+LQD
Sbjct: 1   MNLTELKQKPITELLELAEQMGIENMARSRKQDVIFSLLKKHAKSGEEISGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS DA+YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P+EGERYFALLKV+ IN
Sbjct: 61  GFGFLRSADASYLAGPDDIYVSPSQIRRFNLRTGDTIVGKIRPPKEGERYFALLKVDTIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           FD PE  +NKI F+NLTPL+P  R  ME  N   +D++ RVIDL APIGKGQR LIVAPP
Sbjct: 121 FDRPENAKNKILFENLTPLFPTVRMKMEAGNGSTEDLTGRVIDLCAPIGKGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKTI+LQNIA +I +N+PE +LIVLLIDERPEEVT+MQR+V+GEV++STFDE   RHV
Sbjct: 181 KAGKTIMLQNIAANIARNNPEVHLIVLLIDERPEEVTEMQRTVRGEVVASTFDEPPTRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDA+AL++PKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVIPSSGKVLTGGVDAHALEKPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TALV+TGS+MDEVI+EEFKGTGN E+ L+R+IA+KR+FPA++I
Sbjct: 301 FGAARNIEEGGSLTIIATALVETGSKMDEVIYEEFKGTGNMELPLDRRIAEKRVFPAINI 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQ 422
            KSGTR+E+LL    +LQ++++LR+++  M+   AIEFL+DKLK TK N +FF SM ++
Sbjct: 361 NKSGTRREELLTADDELQRMWILRKLLHPMDEVAAIEFLVDKLKTTKTNDEFFLSMKRK 419


>gi|197287127|ref|YP_002152999.1| transcription termination factor Rho [Proteus mirabilis HI4320]
 gi|227357182|ref|ZP_03841551.1| transcription termination factor Rho [Proteus mirabilis ATCC 29906]
 gi|194684614|emb|CAR46504.1| transcription termination factor Rho [Proteus mirabilis HI4320]
 gi|227162714|gb|EEI47681.1| transcription termination factor Rho [Proteus mirabilis ATCC 29906]
          Length = 419

 Score =  576 bits (1485), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 276/418 (66%), Positives = 345/418 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELKN   ++L+A  E++ +EN   MRKQ+++FSILK  +    +I G+GV+E+LQD
Sbjct: 1   MNLTELKNTPVSELIALGENMGLENLARMRKQDIIFSILKQHAKSGEDIFGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P+EGERYFALLKVN +N
Sbjct: 61  GFGFLRSSDSSYLAGPDDIYVSPSQIRRFNLRTGDTIAGKIRPPKEGERYFALLKVNEVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           FD PE  R+KI F+NLTPL+ + R  ME  N   +D+++RV+DL APIG+GQR LIVAPP
Sbjct: 121 FDKPENARSKILFENLTPLHANNRLRMERGNGSTEDLTARVLDLAAPIGRGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA +I  N+P+C L+VLLIDERPEEVT+MQR V+GEVI+STFDE A+RHV
Sbjct: 181 KAGKTMLLQNIAANIAHNYPDCVLMVLLIDERPEEVTEMQRLVKGEVIASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DV+ILLDSITRL RAYN ++PSSGK+LTGGVDANAL RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVIILLDSITRLARAYNTVVPSSGKVLTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TALVDTGS+MDEVI+EEFKGTGN E+ L RKIA+KR+FPA+D 
Sbjct: 301 FGAARNVEEGGSLTIIATALVDTGSKMDEVIYEEFKGTGNMELHLSRKIAEKRVFPAIDY 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            +SGTRKE+LL  + +LQK+++LR+I+  M   DA+EFLI+KL  TK N++FF  M +
Sbjct: 361 NRSGTRKEELLTSQDELQKMWILRKIIHPMGEIDAMEFLINKLAMTKTNEEFFDFMKR 418


>gi|95929016|ref|ZP_01311761.1| transcription termination factor Rho [Desulfuromonas acetoxidans
           DSM 684]
 gi|95134917|gb|EAT16571.1| transcription termination factor Rho [Desulfuromonas acetoxidans
           DSM 684]
          Length = 489

 Score =  576 bits (1485), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 279/420 (66%), Positives = 343/420 (81%), Gaps = 3/420 (0%)

Query: 2   SEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVL 61
           S M L++LK K  T+L   A  L+IE    MRKQ+++FSIL   + +   I GEGV+E+L
Sbjct: 73  SSMHLKDLKAKKITELTEIANDLKIEGVAGMRKQDVIFSILSATAAQKGAIFGEGVLEIL 132

Query: 62  QDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNA 121
            DGFGFLR+ DANYL GPDDIYVSPSQI+ FSL+TGDT+ G IR P+EGERYFALLKV+ 
Sbjct: 133 PDGFGFLRATDANYLPGPDDIYVSPSQIRRFSLRTGDTISGQIRPPKEGERYFALLKVSE 192

Query: 122 INFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVA 181
           INF+ P   R K  FDNLTPL+P +R  +E  +    +I  RVIDL++PIGKGQR LIVA
Sbjct: 193 INFEDPAVARKKTLFDNLTPLHPQERLVLETTS---DNIPMRVIDLVSPIGKGQRGLIVA 249

Query: 182 PPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAAR 241
           PPRTGKT+LLQN+A+SI  NHPE YLIVLLIDERPEEVTDMQRSVQGEV+SSTFDE A R
Sbjct: 250 PPRTGKTVLLQNLANSITTNHPEAYLIVLLIDERPEEVTDMQRSVQGEVVSSTFDEPATR 309

Query: 242 HVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPK 301
           HVQVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++P SGKIL+GGVD+NAL +PK
Sbjct: 310 HVQVAEMVIQKAKRLVEHKRDVVILLDSITRLARAYNTVVPPSGKILSGGVDSNALHKPK 369

Query: 302 RFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAM 361
           RFFGAARN++EGGSLTII TAL+DTGS+MDEVIFEEFKGTGN E+VL+R++ DKR FPA+
Sbjct: 370 RFFGAARNVEEGGSLTIIATALIDTGSKMDEVIFEEFKGTGNMELVLDRRLVDKRTFPAI 429

Query: 362 DIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
           D+ KSGTR+E+LL +   LQ++++LR+++++MN  D++EFL +KL +TKDN++F  SMN+
Sbjct: 430 DVNKSGTRREELLQDTTTLQRMWLLRKVLTTMNVVDSMEFLREKLVETKDNQEFLDSMNQ 489


>gi|50123131|ref|YP_052298.1| transcription termination factor Rho [Pectobacterium atrosepticum
           SCRI1043]
 gi|49613657|emb|CAG77108.1| transcription termination factor Rho [Pectobacterium atrosepticum
           SCRI1043]
          Length = 419

 Score =  576 bits (1485), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 274/418 (65%), Positives = 343/418 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELKN   ++L+   E++ +EN   MRKQ+++F+ILK  +    +I G+GV+E+LQD
Sbjct: 1   MNLTELKNTPVSELITLGENMGLENQARMRKQDIIFAILKQHAKSGEDIFGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P+EGERYFALLKVN +N
Sbjct: 61  GFGFLRSGDSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNEVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           +D PE  RNKI F+NLTPL+ + R  ME  N   +D+++RV+DL +PIG+GQR LIVAPP
Sbjct: 121 YDKPENARNKILFENLTPLHANSRLRMERGNGSTEDLTARVLDLASPIGRGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA SI  NHP+C L+VLLIDERPEEVT+MQR V+GEVI+STFDE A+RHV
Sbjct: 181 KAGKTMLLQNIAQSIAYNHPDCVLMVLLIDERPEEVTEMQRLVKGEVIASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DV+ILLDSITRL RAYN ++P+SGK+LTGGVDANAL RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVIILLDSITRLARAYNTVVPASGKVLTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TALVDTGS+MDEVI+EEFKGTGN E+ L RKIA+KR+FPA+D 
Sbjct: 301 FGAARNVEEGGSLTIIATALVDTGSKMDEVIYEEFKGTGNMELHLARKIAEKRVFPAIDY 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            +SGTRKE+LL   ++LQK+++LR+I+  M   DA+EFLI+KL  TK N +FF  M +
Sbjct: 361 NRSGTRKEELLTTSEELQKMWILRKIIHPMGEIDAMEFLINKLAMTKTNDEFFDMMKR 418


>gi|227114351|ref|ZP_03828007.1| transcription termination factor Rho [Pectobacterium carotovorum
           subsp. brasiliensis PBR1692]
          Length = 419

 Score =  576 bits (1485), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 273/418 (65%), Positives = 343/418 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELKN   ++L+   E++ +EN   MRKQ+++F+ILK  +    +I G+GV+E+LQD
Sbjct: 1   MNLTELKNTPVSELITLGENMGLENQARMRKQDIIFAILKQHAKSGEDIFGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P+EGERYFALLKVN +N
Sbjct: 61  GFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNEVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           +D PE  RNKI F+NLTPL+ + R  ME  N   +D+++RV+DL +PIG+GQR LIVAPP
Sbjct: 121 YDKPENARNKILFENLTPLHANSRLRMERGNGSTEDLTARVLDLASPIGRGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA SI  NHP+C L+VLLIDERPEEVT+MQR V+GEV++STFDE A+RHV
Sbjct: 181 KAGKTMLLQNIAQSIAYNHPDCVLMVLLIDERPEEVTEMQRLVKGEVVASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DV+ILLDSITRL RAYN ++P+SGK+LTGGVDANAL RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVIILLDSITRLARAYNTVVPASGKVLTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TALVDTGS+MDEVI+EEFKGTGN E+ L RKIA+KR+FPA+D 
Sbjct: 301 FGAARNVEEGGSLTIIATALVDTGSKMDEVIYEEFKGTGNMELHLARKIAEKRVFPAIDY 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            +SGTRKE+LL   ++LQK+++LR+I+  M   DA+EFLI+KL  TK N +FF  M +
Sbjct: 361 NRSGTRKEELLTTSEELQKMWILRKIIHPMGEIDAMEFLINKLAMTKTNDEFFDMMKR 418


>gi|222053784|ref|YP_002536146.1| transcription termination factor Rho [Geobacter sp. FRC-32]
 gi|221563073|gb|ACM19045.1| transcription termination factor Rho [Geobacter sp. FRC-32]
          Length = 415

 Score =  576 bits (1485), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 282/418 (67%), Positives = 344/418 (82%), Gaps = 3/418 (0%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M LQELK K   +L A A+ L IE A+ +RKQ+L+F+IL   + ++  I GEGV+E L D
Sbjct: 1   MNLQELKGKKINELAAIAKGLNIEGASSLRKQDLIFAILNAQTEKNGMIFGEGVLETLPD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLR+PD NYL GPDDIYVSPSQI+ F+L TGDTV G IR P+EGERYFALLKV ++N
Sbjct: 61  GFGFLRAPDYNYLPGPDDIYVSPSQIRRFNLHTGDTVSGQIRPPKEGERYFALLKVESVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
            + P+  R+KI FDNLTPLYP+++  +E   PEN  +S RV++LIAPIGKGQR LIVAPP
Sbjct: 121 HESPDVARDKILFDNLTPLYPEEKLKLE-TTPEN--MSMRVMELIAPIGKGQRGLIVAPP 177

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           RTGKT+L+QNIA+SI +NHPE +LIVLLIDERPEEVTDMQRSV GEVISSTFDE A+RH+
Sbjct: 178 RTGKTMLIQNIANSIAENHPEVFLIVLLIDERPEEVTDMQRSVNGEVISSTFDEPASRHI 237

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++P SGKIL+GGVD+NAL +PKRF
Sbjct: 238 QVAEMVIEKAKRLVEHKRDVVILLDSITRLARAYNTVIPPSGKILSGGVDSNALHKPKRF 297

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TALVDTGS+MDEVIFEEFKGTGN E+ L+RK+ +KR FPA+DI
Sbjct: 298 FGAARNIEEGGSLTIIATALVDTGSKMDEVIFEEFKGTGNMELHLDRKLVEKRTFPAIDI 357

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            KSGTRKE+LL+E+  L ++++LR+++  MN  D++EFL+ KL  TK N+ F  SM+K
Sbjct: 358 NKSGTRKEELLIEKNSLNRIWILRKVLHPMNVVDSMEFLLSKLDGTKSNQAFLDSMSK 415


>gi|183600259|ref|ZP_02961752.1| hypothetical protein PROSTU_03812 [Providencia stuartii ATCC 25827]
 gi|212710198|ref|ZP_03318326.1| hypothetical protein PROVALCAL_01257 [Providencia alcalifaciens DSM
           30120]
 gi|188020048|gb|EDU58088.1| hypothetical protein PROSTU_03812 [Providencia stuartii ATCC 25827]
 gi|212687197|gb|EEB46725.1| hypothetical protein PROVALCAL_01257 [Providencia alcalifaciens DSM
           30120]
          Length = 419

 Score =  576 bits (1484), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 276/418 (66%), Positives = 343/418 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELKN   ++L+   E++ +EN   MRKQ+++FSILK  +    +I G+GV+E+LQD
Sbjct: 1   MNLTELKNTPVSELITLGENMGLENLARMRKQDIIFSILKQHAKSGEDIFGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P+EGERYFALLKVN +N
Sbjct: 61  GFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNEVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           FD PE  R+KI F+NLTPL+ + R  ME  N   +D+++RV+DL APIG+GQR LIVAPP
Sbjct: 121 FDKPENARSKILFENLTPLHANNRLRMERGNGSTEDLTARVLDLAAPIGRGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA +I  N+P+C L+VLLIDERPEEVT+MQR V+GEVI+STFDE AARHV
Sbjct: 181 KAGKTMLLQNIAANIAHNYPDCVLMVLLIDERPEEVTEMQRLVKGEVIASTFDEPAARHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DV+ILLDSITRL RAYN ++PSSGK+LTGGVDANAL RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVIILLDSITRLARAYNTVVPSSGKVLTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TALVDTGS+MDEVI+EEFKGTGN E+ L RKIA+KR+FPA+D 
Sbjct: 301 FGAARNVEEGGSLTIIATALVDTGSKMDEVIYEEFKGTGNMELHLSRKIAEKRVFPAIDY 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            +SGTRKE+LL  + +LQK+++LR+I+  M   DA+EFLI KL  TK N++FF  M +
Sbjct: 361 NRSGTRKEELLTSQDELQKMWILRKIIHPMGEIDAMEFLISKLAMTKTNEEFFDFMKR 418


>gi|253702396|ref|YP_003023585.1| transcription termination factor Rho [Geobacter sp. M21]
 gi|251777246|gb|ACT19827.1| transcription termination factor Rho [Geobacter sp. M21]
          Length = 415

 Score =  576 bits (1484), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 280/418 (66%), Positives = 343/418 (82%), Gaps = 3/418 (0%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M LQELK K    L A A+ L IE A+ +RKQ+L+F+IL   + ++  I GEGV+E L D
Sbjct: 1   MNLQELKEKKINDLTAIAKGLNIEGASSLRKQDLIFAILNAQTEKNGMIFGEGVLETLPD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLR+PD NYL GPDDIYVSPSQI+ F+L TGDTV G IR P+EGERYFALLKV  +N
Sbjct: 61  GFGFLRAPDYNYLPGPDDIYVSPSQIRRFNLHTGDTVAGQIRPPKEGERYFALLKVETVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
            + PE  R+KI FDNLTPLYP ++  +E  +    ++S+RV++LIAPIGKGQR LIVAPP
Sbjct: 121 HESPEVARDKILFDNLTPLYPQEKLKLETTH---DNMSTRVMELIAPIGKGQRGLIVAPP 177

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           RTGKT+L+QNIA+SI  NHPE +LIVLLIDERPEEVTDMQRSV+GEVISSTFDE A+RH+
Sbjct: 178 RTGKTMLIQNIANSIAMNHPEVFLIVLLIDERPEEVTDMQRSVKGEVISSTFDEPASRHI 237

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++P SGKIL+GGVD+NAL +PKRF
Sbjct: 238 QVAEMVIEKAKRLVEHKRDVVILLDSITRLARAYNTVIPPSGKILSGGVDSNALHKPKRF 297

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TALVDTGS+MDEVIFEEFKGTGN E+ L+RK+ +KR FPA+DI
Sbjct: 298 FGAARNIEEGGSLTIIATALVDTGSKMDEVIFEEFKGTGNMELHLDRKLVEKRTFPAIDI 357

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            KSGTRKE+LL+++  L ++++LR+++  MN  D++EFLI KL+ TK N++F  SM+K
Sbjct: 358 NKSGTRKEELLIDKASLNRIWILRKVLHPMNVVDSMEFLISKLQGTKSNQNFLDSMSK 415


>gi|221133953|ref|ZP_03560258.1| transcription termination factor Rho [Glaciecola sp. HTCC2999]
          Length = 421

 Score =  576 bits (1484), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 273/419 (65%), Positives = 344/419 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELKNK  ++L+A +  + +EN    RKQ+++FSILK  +    +I G+GV+E+LQD
Sbjct: 1   MNLTELKNKPISELVALSSEMGLENLARARKQDIIFSILKAHAKSGEDIFGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGD++ G IR P++ ERYFALLK+  +N
Sbjct: 61  GFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDSISGKIRPPKDSERYFALLKIREVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           FD PE  RNKI F+NLTPL+ ++R  ME  N   +DI++RV+DL +PIGKGQR LIVAPP
Sbjct: 121 FDKPENSRNKILFENLTPLHANERLRMERGNGSTEDITARVLDLASPIGKGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA SI  NHP+C L+VLLIDERPEEVT+MQR VQGEVI+STFDE A+RHV
Sbjct: 181 KAGKTLLLQNIAQSIAANHPDCQLMVLLIDERPEEVTEMQRLVQGEVIASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANAL +PKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVIPSSGKVLTGGVDANALHKPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TAL+DTGS+MDEVI+EEFKGTGN E+ L RKIA+KR+FPA+D 
Sbjct: 301 FGAARNVEEGGSLTIIATALIDTGSKMDEVIYEEFKGTGNMELHLNRKIAEKRVFPAIDY 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQ 422
            +SGTR+E+LL  +++LQ++++LR+IV  M   DA+EFLI +L  TK N +FF +M +Q
Sbjct: 361 NRSGTRREELLTNQKELQQMWILRKIVHEMTEIDAMEFLISRLSMTKTNDEFFDAMKRQ 419


>gi|300714783|ref|YP_003739586.1| transcription termination factor Rho [Erwinia billingiae Eb661]
 gi|299060619|emb|CAX57726.1| Transcription termination factor Rho [Erwinia billingiae Eb661]
          Length = 419

 Score =  576 bits (1484), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 275/418 (65%), Positives = 342/418 (81%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELKN   + L+   E++ +EN   MRKQ+++FSILK  +    +I G+GV+E+LQD
Sbjct: 1   MNLTELKNTPVSDLITLGENMGLENQARMRKQDIIFSILKQHAKSGEDIFGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P+EGERYFALLKVN +N
Sbjct: 61  GFGFLRSGDSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNEVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           +D PE  RNKI F+NLTPL+ + R  ME  N   +D+++RV+DL +PIG+GQR LIVAPP
Sbjct: 121 YDKPENARNKILFENLTPLHANSRLRMERGNGSTEDLTARVLDLASPIGRGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA SI  NHP+C L+VLLIDERPEEVT+MQR V+GEVI+STFDE A+RHV
Sbjct: 181 KAGKTMLLQNIATSIAYNHPDCVLMVLLIDERPEEVTEMQRLVKGEVIASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DV+ILLDSITRL RAYN ++P+SGK+LTGGVDANAL RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVIILLDSITRLARAYNTVVPASGKVLTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TALVDTGS+MDEVI+EEFKGTGN E+ L RKIA+KR+FPA+D 
Sbjct: 301 FGAARNVEEGGSLTIIATALVDTGSKMDEVIYEEFKGTGNMELHLARKIAEKRVFPAIDY 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            +SGTRKE+LL   ++LQK+++LR+I+  M   DA+EFLI+KL  TK N +FF  M +
Sbjct: 361 NRSGTRKEELLTSSEELQKMWILRKIIHPMGEIDAMEFLINKLAMTKTNDEFFDMMKR 418


>gi|268592934|ref|ZP_06127155.1| transcription termination factor Rho [Providencia rettgeri DSM
           1131]
 gi|291311726|gb|EFE52179.1| transcription termination factor Rho [Providencia rettgeri DSM
           1131]
          Length = 419

 Score =  576 bits (1484), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 275/418 (65%), Positives = 344/418 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELKN   ++L+   E++ +EN   MRKQ+++FSILK  +    +I G+GV+E+LQD
Sbjct: 1   MNLTELKNTPVSELITLGENMGLENLARMRKQDIIFSILKQHAKSGEDIFGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P+EGERYFALLKVN +N
Sbjct: 61  GFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNEVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           +D PE  R+KI F+NLTPL+ ++R  ME  N   +D+++RV+DL APIG+GQR LIVAPP
Sbjct: 121 YDKPENARSKILFENLTPLHANRRLRMERGNGSTEDLTARVLDLAAPIGRGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA +I  N+P+C L+VLLIDERPEEVT+MQR V+GEVI+STFDE AARHV
Sbjct: 181 KAGKTMLLQNIAANIAHNYPDCVLMVLLIDERPEEVTEMQRLVKGEVIASTFDEPAARHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DV+ILLDSITRL RAYN ++PSSGK+LTGGVDANAL RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVIILLDSITRLARAYNTVVPSSGKVLTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TALVDTGS+MDEVI+EEFKGTGN E+ L RKIA+KR+FPA+D 
Sbjct: 301 FGAARNVEEGGSLTIIATALVDTGSKMDEVIYEEFKGTGNMELHLSRKIAEKRVFPAIDY 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            +SGTRKE+LL  + +LQK+++LR+I+  M   DA+EFLI KL  TK N++FF  M +
Sbjct: 361 NRSGTRKEELLTSQDELQKMWILRKIIHPMGEIDAMEFLISKLAMTKTNEEFFDFMKR 418


>gi|260770666|ref|ZP_05879597.1| transcription termination factor Rho [Vibrio furnissii CIP 102972]
 gi|260614392|gb|EEX39580.1| transcription termination factor Rho [Vibrio furnissii CIP 102972]
 gi|315178382|gb|ADT85296.1| transcription termination factor Rho [Vibrio furnissii NCTC 11218]
          Length = 409

 Score =  576 bits (1484), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 275/408 (67%), Positives = 339/408 (83%)

Query: 15  TKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQDGFGFLRSPDAN 74
           + L+   ESL +EN   +RKQ+++FSILK  +    +I G+GV+E+LQDGFGFLRS D++
Sbjct: 2   SDLVKLGESLGLENLARLRKQDIIFSILKAHAKSGEDIFGDGVLEILQDGFGFLRSADSS 61

Query: 75  YLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAINFDVPERVRNKI 134
           YLAGPDDIYVSPSQI+ F+L+TGD++ G IR P+EGERYFALLKVN +N D P+  RNKI
Sbjct: 62  YLAGPDDIYVSPSQIRRFNLRTGDSIAGKIRPPKEGERYFALLKVNTVNDDKPDNARNKI 121

Query: 135 HFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPPRTGKTILLQNI 194
            F+NLTPL+ ++R  ME  N   +DI++RV+DL APIGKGQR LIVAPP+ GKT+LLQNI
Sbjct: 122 LFENLTPLHANERMVMERGNGSTEDITARVLDLAAPIGKGQRGLIVAPPKAGKTMLLQNI 181

Query: 195 AHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHVQVAEMVIAKAK 254
           A SI  NHPEC L+VLLIDERPEEVT+MQR V+GEV++STFDE A+RHVQVAEMVI KAK
Sbjct: 182 AQSIASNHPECVLMVLLIDERPEEVTEMQRLVKGEVVASTFDEPASRHVQVAEMVIEKAK 241

Query: 255 CLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRFFGAARNIKEGG 314
            LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANAL RPKRFFGAARN++EGG
Sbjct: 242 RLVEHKKDVVILLDSITRLARAYNTVVPSSGKVLTGGVDANALHRPKRFFGAARNVEEGG 301

Query: 315 SLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDIIKSGTRKEDLL 374
           SLTII TALVDTGS+MDEVI+EEFKGTGN E+ L RKIA+KR+FPA+D  +SGTR+E+LL
Sbjct: 302 SLTIIATALVDTGSKMDEVIYEEFKGTGNMELHLNRKIAEKRVFPAIDFNRSGTRREELL 361

Query: 375 VERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQ 422
            +  +LQK+++LR+IV  M  +DA+EFLIDKL  TK N +FF +M +Q
Sbjct: 362 TKTDELQKMWILRKIVHPMGETDAMEFLIDKLAMTKTNDEFFDAMRRQ 409


>gi|251787808|ref|YP_003002529.1| transcription termination factor Rho [Dickeya zeae Ech1591]
 gi|247536429|gb|ACT05050.1| transcription termination factor Rho [Dickeya zeae Ech1591]
          Length = 419

 Score =  575 bits (1483), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 271/418 (64%), Positives = 344/418 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELKN   ++L+   E++ +EN   MRKQ+++F+ILK  +    +I G+GV+E+LQD
Sbjct: 1   MNLTELKNTPVSELITLGENMGLENLARMRKQDIIFAILKQHAKSGEDIFGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P+EGERYFALLKVN +N
Sbjct: 61  GFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNEVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           +D PE  R+KI F+NLTPL+ + R  ME  N   +D+++RV+DL +PIG+GQR LIVAPP
Sbjct: 121 YDKPENARSKILFENLTPLHANSRLRMERGNGSTEDLTARVLDLASPIGRGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA SI  NHP+C L+VLLIDERPEEVT+MQR V+GEV++STFDE A+RHV
Sbjct: 181 KAGKTMLLQNIAQSIAYNHPDCVLMVLLIDERPEEVTEMQRLVKGEVVASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DV+ILLDSITRL RAYN ++P+SGK+LTGGVDANAL RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVIILLDSITRLARAYNTVVPASGKVLTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TAL+DTGS+MDEVI+EEFKGTGN E+ L RKIA+KR+FPA+D 
Sbjct: 301 FGAARNVEEGGSLTIIATALIDTGSKMDEVIYEEFKGTGNMELHLSRKIAEKRVFPAIDY 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            +SGTRKE+LL   ++LQK+++LR+I+  M  +DA+EFLI+KL  TK N +FF  M +
Sbjct: 361 NRSGTRKEELLTTSEELQKMWILRKIIHPMGETDAMEFLINKLAMTKTNDEFFDMMKR 418


>gi|304398132|ref|ZP_07380007.1| transcription termination factor Rho [Pantoea sp. aB]
 gi|308188837|ref|YP_003932968.1| Transcription termination factor rho [Pantoea vagans C9-1]
 gi|304354418|gb|EFM18790.1| transcription termination factor Rho [Pantoea sp. aB]
 gi|308059347|gb|ADO11519.1| Transcription termination factor rho [Pantoea vagans C9-1]
          Length = 419

 Score =  575 bits (1483), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 274/418 (65%), Positives = 344/418 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELKN    +L+   E++ +EN   MRKQ+++FSILK  +    +I G+GV+E+LQD
Sbjct: 1   MNLTELKNTPVAELITLGENMGLENQARMRKQDIIFSILKQHAKSGEDIFGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P+EGERYFALLKVN +N
Sbjct: 61  GFGFLRSGDSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNEVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           +D PE  RNKI F+NLTPL+ +KR  ME  N   +D+++RV+DL +PIG+GQR LIVAPP
Sbjct: 121 YDKPENARNKILFENLTPLHANKRLRMERGNGSTEDLTARVLDLASPIGRGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA S+  N+P+C L+VLLIDERPEEVT+MQR V+GEVI+STFDE A+RHV
Sbjct: 181 KAGKTMLLQNIAQSLAYNYPDCVLMVLLIDERPEEVTEMQRLVKGEVIASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DV+ILLDSITRL RAYN ++P+SGK+LTGGVDANAL RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVIILLDSITRLARAYNTVVPASGKVLTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TALVDTGS+MDEVI+EEFKGTGN E+ L RKIA+KR+FPA+D 
Sbjct: 301 FGAARNVEEGGSLTIIATALVDTGSKMDEVIYEEFKGTGNMELHLARKIAEKRVFPAIDY 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            +SGTRKE+LL  +++LQK+++LR+I+  M   DA+EFLI+KL  TK N +FF  M +
Sbjct: 361 NRSGTRKEELLTSQEELQKMWILRKIIHPMGEIDAMEFLINKLAMTKTNDEFFDMMKR 418


>gi|322421629|ref|YP_004200852.1| transcription termination factor Rho [Geobacter sp. M18]
 gi|320128016|gb|ADW15576.1| transcription termination factor Rho [Geobacter sp. M18]
          Length = 415

 Score =  575 bits (1483), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 282/418 (67%), Positives = 343/418 (82%), Gaps = 3/418 (0%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M LQELK K    L A A+ L IE A+ +RKQ+L+F+IL   + ++  I GEGV+E L D
Sbjct: 1   MNLQELKEKKINDLTAIAKGLNIEGASSLRKQDLIFAILNAQTEKNGMIFGEGVLETLPD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLR+PD NYL GPDDIYVSPSQI+ F+L TGDTV G IR P+EGERYFALLKV  +N
Sbjct: 61  GFGFLRAPDYNYLPGPDDIYVSPSQIRRFNLHTGDTVAGQIRPPKEGERYFALLKVETVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
            + PE  R+KI FDNLTPLYP ++  +E   P+N  +SSRV++L+APIGKGQR LIVAPP
Sbjct: 121 HESPEVARDKILFDNLTPLYPQEKLKLE-TTPDN--MSSRVMELVAPIGKGQRGLIVAPP 177

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           RTGKT+L+QNIA+SI  NHPE +LIVLLIDERPEEVTDMQRSV+GEVISSTFDE A+RH+
Sbjct: 178 RTGKTMLIQNIANSIALNHPEVFLIVLLIDERPEEVTDMQRSVKGEVISSTFDEPASRHI 237

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++P SGKIL+GGVD+NAL +PKRF
Sbjct: 238 QVAEMVIEKAKRLVEHKRDVVILLDSITRLARAYNTVIPPSGKILSGGVDSNALHKPKRF 297

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TALVDTGS+MDEVIFEEFKGTGN E+ L+RK+ +KR FPA+DI
Sbjct: 298 FGAARNIEEGGSLTIIATALVDTGSKMDEVIFEEFKGTGNMELHLDRKLVEKRTFPAIDI 357

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            KSGTRKE+LL+++  L ++++LR+++  MN  D++EFLI KL+ TK N+ F  SM+K
Sbjct: 358 NKSGTRKEELLIDKASLNRIWILRKVLHPMNVVDSMEFLISKLQGTKSNQGFLDSMSK 415


>gi|317494809|ref|ZP_07953220.1| transcription termination factor Rho [Enterobacteriaceae bacterium
           9_2_54FAA]
 gi|316917134|gb|EFV38482.1| transcription termination factor Rho [Enterobacteriaceae bacterium
           9_2_54FAA]
          Length = 419

 Score =  575 bits (1483), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 274/418 (65%), Positives = 343/418 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELKN   ++L+   E++ +EN   MRKQ+++F+ILK  +    +I G+GV+E+LQD
Sbjct: 1   MNLTELKNTPVSELITLGENMGLENLARMRKQDIIFAILKQHAKSGEDIFGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P+EGERYFALLKVN +N
Sbjct: 61  GFGFLRSGDSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNEVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           +D PE  R+KI F+NLTPL+ + R  ME  N   +D+++RV+DL +PIG+GQR LIVAPP
Sbjct: 121 YDKPENARSKILFENLTPLHANSRLRMERGNGSTEDLTARVLDLASPIGRGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA SI  NHP+C L+VLLIDERPEEVT+MQR V+GEVI+STFDE A+RHV
Sbjct: 181 KAGKTMLLQNIAQSIAYNHPDCTLMVLLIDERPEEVTEMQRLVKGEVIASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DV+ILLDSITRL RAYN ++P+SGK+LTGGVDANAL RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVIILLDSITRLARAYNTVVPASGKVLTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TALVDTGS+MDEVI+EEFKGTGN E+ L RKIA+KR+FPA+D 
Sbjct: 301 FGAARNVEEGGSLTIIATALVDTGSKMDEVIYEEFKGTGNMELHLSRKIAEKRVFPAIDY 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            +SGTRKE+LL   ++LQK+++LR+I+  M   DA+EFLI+KL  TK N DFF  M +
Sbjct: 361 NRSGTRKEELLTTSEELQKMWILRKIIHPMGEIDAMEFLINKLAMTKTNDDFFDMMKR 418


>gi|253775592|ref|YP_003038423.1| transcription termination factor Rho [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254163727|ref|YP_003046835.1| transcription termination factor Rho [Escherichia coli B str.
           REL606]
 gi|242379316|emb|CAQ34127.1| transcription termination factor Rho monomer; polarity suppressor,
           subunit of transcription termination factor Rho
           [Escherichia coli BL21(DE3)]
 gi|253326636|gb|ACT31238.1| transcription termination factor Rho [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|253975628|gb|ACT41299.1| transcription termination factor Rho [Escherichia coli B str.
           REL606]
 gi|253979784|gb|ACT45454.1| transcription termination factor Rho [Escherichia coli BL21(DE3)]
          Length = 419

 Score =  575 bits (1483), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 273/418 (65%), Positives = 343/418 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELKN   ++L+   E++ +EN   MRKQ+++F+ILK  +    +I G+GV+E+LQD
Sbjct: 1   MNLTELKNTPVSELITLGENMGLENLARMRKQDIIFAILKQHAKSGEDIFGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVS SQI+ F+L+TGDT+ G IR P+EGERYFALLKVN +N
Sbjct: 61  GFGFLRSADSSYLAGPDDIYVSLSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNEVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           FD PE  RNKI F+NLTPL+ + R  ME  N   +D+++RV+DL +PIG+GQR LIVAPP
Sbjct: 121 FDKPENARNKILFENLTPLHANSRLRMERGNGSTEDLTARVLDLASPIGRGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA SI  NHP+C L+VLLIDERPEEVT+MQR V+GEV++STFDE A+RHV
Sbjct: 181 KAGKTMLLQNIAQSIAYNHPDCVLMVLLIDERPEEVTEMQRLVKGEVVASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DV+ILLDSITRL RAYN ++P+SGK+LTGGVDANAL RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVIILLDSITRLARAYNTVVPASGKVLTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TAL+DTGS+MDEVI+EEFKGTGN E+ L RKIA+KR+FPA+D 
Sbjct: 301 FGAARNVEEGGSLTIIATALIDTGSKMDEVIYEEFKGTGNMELHLSRKIAEKRVFPAIDY 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            +SGTRKE+LL  +++LQK+++LR+I+  M   DA+EFLI+KL  TK N DFF  M +
Sbjct: 361 NRSGTRKEELLTTQEELQKMWILRKIIHPMGEIDAMEFLINKLAMTKTNDDFFEMMKR 418


>gi|320540200|ref|ZP_08039855.1| transcription termination factor [Serratia symbiotica str. Tucson]
 gi|320029866|gb|EFW11890.1| transcription termination factor [Serratia symbiotica str. Tucson]
          Length = 419

 Score =  575 bits (1483), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 275/418 (65%), Positives = 342/418 (81%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELKN   + L+   E++ +EN   MRKQ+++FSILK  +    +I G+GV+E+LQD
Sbjct: 1   MNLTELKNTPVSDLITLGENMGLENLARMRKQDIIFSILKQHAKSGEDIFGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P+EGERYFALLKVN +N
Sbjct: 61  GFGFLRSGDSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNEVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           +D PE  R+KI F+NLTPL+ + R  ME  N   +D+++RV+DL APIG+GQR LIVAPP
Sbjct: 121 YDKPENARSKILFENLTPLHANSRLRMERGNGSTEDLTARVLDLAAPIGRGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA SI  NHP+C L+VLLIDERPEEVT+MQR V+GEVI+STFDE A+RHV
Sbjct: 181 KAGKTMLLQNIAQSIAYNHPDCVLMVLLIDERPEEVTEMQRLVKGEVIASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DV+ILLDSITRL RAYN ++P+SGK+LTGGVDANAL RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVIILLDSITRLARAYNTVVPASGKVLTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TALVDTGS+MDEVI+EEFKGTGN E+ L RKIA+KR+FPA+D 
Sbjct: 301 FGAARNVEEGGSLTIIATALVDTGSKMDEVIYEEFKGTGNMELHLARKIAEKRVFPAIDY 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            +SGTRKE+LL   ++LQK+++LR+I+  M   DA+EFLI+KL  TK N +FF  M +
Sbjct: 361 NRSGTRKEELLTTSEELQKMWILRKIIHPMGEIDAMEFLINKLAMTKTNDEFFDMMKR 418


>gi|261823428|ref|YP_003261534.1| transcription termination factor Rho [Pectobacterium wasabiae
           WPP163]
 gi|261607441|gb|ACX89927.1| transcription termination factor Rho [Pectobacterium wasabiae
           WPP163]
          Length = 450

 Score =  575 bits (1483), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 273/420 (65%), Positives = 344/420 (81%)

Query: 2   SEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVL 61
           + M L ELKN   ++L+   E++ +EN   MRKQ+++F+ILK  +    +I G+GV+E+L
Sbjct: 30  TTMNLTELKNTPVSELITLGENMGLENQARMRKQDIIFAILKQHAKSGEDIFGDGVLEIL 89

Query: 62  QDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNA 121
           QDGFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P+EGERYFALLKVN 
Sbjct: 90  QDGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNE 149

Query: 122 INFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVA 181
           +N+D PE  RNKI F+NLTPL+ + R  ME  N   +D+++RV+DL +PIG+GQR LIVA
Sbjct: 150 VNYDRPENARNKILFENLTPLHANSRLRMERGNGSTEDLTARVLDLASPIGRGQRGLIVA 209

Query: 182 PPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAAR 241
           PP+ GKT+LLQNIA SI  NHP+C L+VLLIDERPEEVT+MQR V+GEV++STFDE A+R
Sbjct: 210 PPKAGKTMLLQNIAQSIAYNHPDCVLMVLLIDERPEEVTEMQRLVKGEVVASTFDEPASR 269

Query: 242 HVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPK 301
           HVQVAEMVI KAK LVE+  DV+ILLDSITRL RAYN ++P+SGK+LTGGVDANAL RPK
Sbjct: 270 HVQVAEMVIEKAKRLVEHKKDVIILLDSITRLARAYNTVVPASGKVLTGGVDANALHRPK 329

Query: 302 RFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAM 361
           RFFGAARN++EGGSLTII TALVDTGS+MDEVI+EEFKGTGN E+ L RKIA+KR+FPA+
Sbjct: 330 RFFGAARNVEEGGSLTIIATALVDTGSKMDEVIYEEFKGTGNMELHLARKIAEKRVFPAI 389

Query: 362 DIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
           D  +SGTRKE+LL   ++LQK+++LR+I+  M   DA+EFLI+KL  TK N +FF  M +
Sbjct: 390 DYNRSGTRKEELLTTSEELQKMWILRKIIHPMGEIDAMEFLINKLAMTKTNDEFFDMMKR 449


>gi|188532353|ref|YP_001906150.1| transcription termination factor Rho [Erwinia tasmaniensis Et1/99]
 gi|188027395|emb|CAO95242.1| Transcription termination factor Rho [Erwinia tasmaniensis Et1/99]
          Length = 419

 Score =  575 bits (1483), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 274/418 (65%), Positives = 342/418 (81%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELKN   + L+   E++ +EN   MRKQ+++F+ILK  +    +I G+GV+E+LQD
Sbjct: 1   MNLTELKNTPVSDLITLGENMGLENLARMRKQDIIFAILKQHAKSGEDIFGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P+EGERYFALLKVN +N
Sbjct: 61  GFGFLRSGDSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNEVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           +D PE  RNKI F+NLTPL+ + R  ME  N   +D+++RV+DL +PIG+GQR LIVAPP
Sbjct: 121 YDKPENARNKILFENLTPLHANSRLRMERGNGSTEDLTARVLDLASPIGRGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA SI  NHP+C L+VLLIDERPEEVT+MQR V+GEVI+STFDE A+RHV
Sbjct: 181 KAGKTMLLQNIAQSIAYNHPDCVLMVLLIDERPEEVTEMQRLVKGEVIASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DV+ILLDSITRL RAYN ++P+SGK+LTGGVDANAL RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVIILLDSITRLARAYNTVVPASGKVLTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TALVDTGS+MDEVI+EEFKGTGN E+ L RKIA+KR+FPA+D 
Sbjct: 301 FGAARNVEEGGSLTIIATALVDTGSKMDEVIYEEFKGTGNMELHLARKIAEKRVFPAIDY 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            +SGTRKE+LL   ++LQK+++LR+I+  M   DA+EFLI+KL  TK N +FF  M +
Sbjct: 361 NRSGTRKEELLTSSEELQKMWILRKIIHPMGEIDAMEFLINKLAMTKTNDEFFDMMKR 418


>gi|315125228|ref|YP_004067231.1| transcription termination factor Rho [Pseudoalteromonas sp. SM9913]
 gi|315013741|gb|ADT67079.1| transcription termination factor Rho [Pseudoalteromonas sp. SM9913]
          Length = 419

 Score =  575 bits (1482), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 276/419 (65%), Positives = 347/419 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L+ELK+KS  +L+  AES+ +EN   +RKQ+++F+ILK  +     I G GV+E+LQD
Sbjct: 1   MHLRELKDKSIKELVNLAESMGLENVARLRKQDIIFAILKSHAKGGENIFGGGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS +A+YLAGPDDIYVSPSQI+ FS++TGD++ G IR P++GERYFALLKVN +N
Sbjct: 61  GFGFLRSSEASYLAGPDDIYVSPSQIRRFSMRTGDSISGLIRPPKDGERYFALLKVNEVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           FD PE  R KI F+NLTPL+ ++RF ME  N   +DI++RV+DL +PIG+GQR L+VAPP
Sbjct: 121 FDKPENSRTKILFENLTPLHANERFRMERGNGSKEDITARVLDLASPIGRGQRGLLVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA SI  NHP+  L+VLLIDERPEEVT+MQR V+GEVI+STFDE A+RHV
Sbjct: 181 KAGKTMLLQNIAQSITHNHPDVTLMVLLIDERPEEVTEMQRLVKGEVIASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANAL +PKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVIPSSGKVLTGGVDANALHKPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TAL+DTGS+MDEVI+EEFKGTGN E+ L RKIA+KR+FPA+D 
Sbjct: 301 FGAARNVEEGGSLTIIATALIDTGSKMDEVIYEEFKGTGNMELHLNRKIAEKRVFPAIDF 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQ 422
            +SGTR+E+LL +  +LQK+++LR+IV  M+  DA+EFLIDKL  +K N +FF SM +Q
Sbjct: 361 NRSGTRREELLTKPDELQKLWILRKIVHDMSEIDAMEFLIDKLSMSKTNDEFFDSMKRQ 419


>gi|330812504|ref|YP_004356966.1| Rho transcription termination factor [Pseudomonas brassicacearum
           subsp. brassicacearum NFM421]
 gi|327380612|gb|AEA71962.1| putative Rho transcription termination factor [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
          Length = 419

 Score =  575 bits (1482), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 278/419 (66%), Positives = 346/419 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK K  T+LL  AE + IEN    RKQ+++FS+LK  +    EI G+GV+E+LQD
Sbjct: 1   MNLTELKQKPITELLELAEQMGIENMARSRKQDVIFSLLKKHAKSGEEISGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS DA+YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P+EGERYFALLKV+ IN
Sbjct: 61  GFGFLRSADASYLAGPDDIYVSPSQIRRFNLRTGDTIVGKIRPPKEGERYFALLKVDTIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           FD PE  +NKI F+NLTPL+P  R  ME  N   +D++ RVIDL APIGKGQR LIVAPP
Sbjct: 121 FDRPENAKNKILFENLTPLFPTVRMKMEAGNGSTEDLTGRVIDLCAPIGKGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKTI+LQNIA +I +N+PE +LIVLLIDERPEEVT+MQR+V+GEV++STFDE   RHV
Sbjct: 181 KAGKTIMLQNIAANIARNNPEVHLIVLLIDERPEEVTEMQRTVRGEVVASTFDEPPTRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDA+AL++PKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVIPSSGKVLTGGVDAHALEKPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TALV+TGS+MDEVI+EEFKGTGN E+ L+R+IA+KR+FPA++I
Sbjct: 301 FGAARNIEEGGSLTIIATALVETGSKMDEVIYEEFKGTGNMELPLDRRIAEKRVFPAINI 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQ 422
            +SGTR+E+LL    +LQ++++LR+++  M+   AIEFL+DKLK TK N +FF SM ++
Sbjct: 361 NRSGTRREELLTADDELQRMWILRKLLHPMDEVAAIEFLVDKLKTTKTNDEFFLSMKRK 419


>gi|259906865|ref|YP_002647221.1| transcription termination factor Rho [Erwinia pyrifoliae Ep1/96]
 gi|292486658|ref|YP_003529528.1| transcription termination factor rho [Erwinia amylovora CFBP1430]
 gi|292897895|ref|YP_003537264.1| transcription termination factor Rho [Erwinia amylovora ATCC 49946]
 gi|224962487|emb|CAX53942.1| Transcription termination factor Rho [Erwinia pyrifoliae Ep1/96]
 gi|283476657|emb|CAY72485.1| Transcription termination factor rho [Erwinia pyrifoliae DSM 12163]
 gi|291197743|emb|CBJ44838.1| transcription termination factor Rho [Erwinia amylovora ATCC 49946]
 gi|291552075|emb|CBA19112.1| Transcription termination factor rho [Erwinia amylovora CFBP1430]
 gi|310766113|gb|ADP11063.1| transcription termination factor Rho [Erwinia sp. Ejp617]
 gi|312170724|emb|CBX78986.1| Transcription termination factor rho [Erwinia amylovora ATCC
           BAA-2158]
          Length = 419

 Score =  575 bits (1482), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 274/418 (65%), Positives = 342/418 (81%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELKN   + L+   E++ +EN   MRKQ+++F+ILK  +    +I G+GV+E+LQD
Sbjct: 1   MNLTELKNTPVSDLITLGENMGLENLARMRKQDIIFAILKQHAKSGEDIFGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P+EGERYFALLKVN +N
Sbjct: 61  GFGFLRSGDSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNEVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           +D PE  RNKI F+NLTPL+ + R  ME  N   +D+++RV+DL +PIG+GQR LIVAPP
Sbjct: 121 YDKPENARNKILFENLTPLHANSRLRMERGNGSTEDLTARVLDLASPIGRGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA SI  NHP+C L+VLLIDERPEEVT+MQR V+GEVI+STFDE A+RHV
Sbjct: 181 KAGKTMLLQNIAQSIAYNHPDCVLMVLLIDERPEEVTEMQRLVKGEVIASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DV+ILLDSITRL RAYN ++P+SGK+LTGGVDANAL RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVIILLDSITRLARAYNTVVPASGKVLTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TALVDTGS+MDEVI+EEFKGTGN E+ L RKIA+KR+FPA+D 
Sbjct: 301 FGAARNVEEGGSLTIIATALVDTGSKMDEVIYEEFKGTGNMELHLARKIAEKRVFPAIDY 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            +SGTRKE+LL   ++LQK+++LR+I+  M   DA+EFLI+KL  TK N +FF  M +
Sbjct: 361 NRSGTRKEELLTTSEELQKMWILRKIIHPMGEIDAMEFLINKLAMTKTNDEFFDMMKR 418


>gi|85060364|ref|YP_456066.1| transcription termination factor Rho [Sodalis glossinidius str.
           'morsitans']
 gi|84780884|dbj|BAE75661.1| transcription termination factor Rho [Sodalis glossinidius str.
           'morsitans']
          Length = 419

 Score =  575 bits (1482), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 272/418 (65%), Positives = 344/418 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELKN   ++L+   E++ +EN   MRKQ+++F+ILK  +    +I G+GV+E+LQD
Sbjct: 1   MNLTELKNTPVSELVTLGENMGLENLARMRKQDIIFAILKQHAKSGEDIFGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P+EGERYFALLKVN +N
Sbjct: 61  GFGFLRSSDSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNEVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           +D PE  RNKI F+NLTPL+ + R  ME  N   +D+++RV+DL +PIG+GQR LIVAPP
Sbjct: 121 YDKPENARNKILFENLTPLHANSRLRMERGNGSTEDLTARVLDLASPIGRGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA SI  NHP+C L+VLLIDERPEEVT+MQR V+GEVI+STFDE A+RHV
Sbjct: 181 KAGKTMLLQNIAQSIAYNHPDCVLMVLLIDERPEEVTEMQRLVKGEVIASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DV+ILLDSITRL RAYN ++P+SGK+LTGGVDANAL RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVIILLDSITRLARAYNTVVPASGKVLTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TAL+DTGS+MDEVI+EEFKGTGN E+ L RKIA+KR+FPA+D 
Sbjct: 301 FGAARNMEEGGSLTIIATALIDTGSKMDEVIYEEFKGTGNMELHLSRKIAEKRVFPAIDY 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            +SGTRKE+LL  +++LQK+++LR+I+  M   DA+EFL++KL  TK N +FF  M +
Sbjct: 361 NRSGTRKEELLTTQEELQKMWILRKIIHPMGEIDAMEFLMNKLAMTKTNDEFFDMMKR 418


>gi|317046376|ref|YP_004114024.1| transcription termination factor Rho [Pantoea sp. At-9b]
 gi|316947993|gb|ADU67468.1| transcription termination factor Rho [Pantoea sp. At-9b]
          Length = 419

 Score =  575 bits (1482), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 273/418 (65%), Positives = 343/418 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELKN   ++L+   E++ +EN   MRKQ+++F+ILK  +    +I G+GV+E+LQD
Sbjct: 1   MNLTELKNTPVSELITLGENMGLENLARMRKQDIIFAILKQHAKSGEDIFGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P+EGERYFALLKVN +N
Sbjct: 61  GFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNEVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           +D PE  R+KI F+NLTPL+ + R  ME  N   +D+++RV+DL +PIG+GQR LIVAPP
Sbjct: 121 YDKPENARSKILFENLTPLHANSRLRMERGNGSTEDLTARVLDLASPIGRGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA SI  NHP+C L+VLLIDERPEEVT+MQR V+GEVI+STFDE A+RHV
Sbjct: 181 KAGKTMLLQNIAQSIAYNHPDCVLMVLLIDERPEEVTEMQRLVKGEVIASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DV+ILLDSITRL RAYN ++P+SGK+LTGGVDANAL RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVIILLDSITRLARAYNTVVPASGKVLTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TALVDTGS+MDEVI+EEFKGTGN E+ L RKIA+KR+FPA+D 
Sbjct: 301 FGAARNVEEGGSLTIIATALVDTGSKMDEVIYEEFKGTGNMELHLSRKIAEKRVFPAIDY 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            +SGTRKE+LL   ++LQK+++LR+I+  M   DA+EFLI+KL  TK N +FF  M +
Sbjct: 361 NRSGTRKEELLTSSEELQKMWILRKIIHPMGEIDAMEFLINKLAMTKTNDEFFDMMKR 418


>gi|229593267|ref|YP_002875386.1| transcription termination factor Rho [Pseudomonas fluorescens
           SBW25]
 gi|312963769|ref|ZP_07778240.1| Transcription termination factor rho [Pseudomonas fluorescens WH6]
 gi|1710264|sp|P52155|RHO_PSEFC RecName: Full=Transcription termination factor Rho; AltName:
           Full=ATP-dependent helicase Rho
 gi|454841|gb|AAA59209.1| 'The first ATG in the open reading frame was chosen as the
           initiation codon.' [Pseudomonas fluorescens]
 gi|229365133|emb|CAY53368.1| transcription termination factor [Pseudomonas fluorescens SBW25]
 gi|311281804|gb|EFQ60414.1| Transcription termination factor rho [Pseudomonas fluorescens WH6]
          Length = 419

 Score =  575 bits (1481), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 279/419 (66%), Positives = 345/419 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK K  T LL  AE + IEN    RKQ+++FS+LK  +    EI G+GV+E+LQD
Sbjct: 1   MNLTELKQKPITDLLQLAEEMGIENMARSRKQDVIFSLLKKHAKSGEEISGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS DA+YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P+EGERYFALLKV+ IN
Sbjct: 61  GFGFLRSADASYLAGPDDIYVSPSQIRRFNLRTGDTIVGKIRPPKEGERYFALLKVDTIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           FD PE  +NKI F+NLTPL+P  R  ME  N   +D++ RVIDL APIGKGQR LIVAPP
Sbjct: 121 FDRPENAKNKILFENLTPLFPTVRMKMEAGNGSTEDLTGRVIDLCAPIGKGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKTI+LQNIA +I +N+PE +LIVLLIDERPEEVT+MQR+V+GEV++STFDE   RHV
Sbjct: 181 KAGKTIMLQNIAANIARNNPEVHLIVLLIDERPEEVTEMQRTVRGEVVASTFDEPPTRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDA+AL++PKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVIPSSGKVLTGGVDAHALEKPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TALV+TGS+MDEVI+EEFKGTGN E+ L+R+IA+KR+FPA++I
Sbjct: 301 FGAARNIEEGGSLTIIATALVETGSKMDEVIYEEFKGTGNMELPLDRRIAEKRVFPAINI 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQ 422
            +SGTR+E+LL    +LQ++++LR+++  M+   AIEFLIDKLK TK N +FF SM ++
Sbjct: 361 NRSGTRREELLTADDELQRMWILRKLLHPMDEVAAIEFLIDKLKTTKTNDEFFLSMKRK 419


>gi|110835324|ref|YP_694183.1| transcription termination factor Rho [Alcanivorax borkumensis SK2]
 gi|254429860|ref|ZP_05043567.1| transcription termination factor Rho [Alcanivorax sp. DG881]
 gi|110648435|emb|CAL17911.1| transcription termination factor Rho [Alcanivorax borkumensis SK2]
 gi|196196029|gb|EDX90988.1| transcription termination factor Rho [Alcanivorax sp. DG881]
          Length = 419

 Score =  575 bits (1481), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 274/419 (65%), Positives = 348/419 (83%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK K   +LL  A+ L +EN    RKQ+++FSILK  +    +I G+GV+E+LQD
Sbjct: 1   MNLSELKQKPIGELLDIAKELGLENLARTRKQDVIFSILKRAAKNGSDIYGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS + +YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P++GERYFA+LKVN IN
Sbjct: 61  GFGFLRSAEGSYLAGPDDIYVSPSQIRRFNLRTGDTIAGKIRPPKDGERYFAMLKVNEIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           FD PE  +NKI F+NLTPL+P +R  ME+ N   +DI++RVIDL+APIGKGQR LIVAPP
Sbjct: 121 FDRPENAKNKILFENLTPLFPTQRLVMEIGNGSTEDITTRVIDLVAPIGKGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQ++A SI +N+PE ++IVLLIDERPEEVT+M R+V+GEV++STFDE  ARHV
Sbjct: 181 KAGKTMLLQSVAQSIARNNPETHMIVLLIDERPEEVTEMSRTVRGEVVASTFDEPPARHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN + PSSGK+LTGGVDA+AL++PKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKQDVVILLDSITRLARAYNTVQPSSGKVLTGGVDAHALEKPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTI+ TALVDTGS+MDEVI+EEFKGTGN E+ L+RK+A+KR+FPAM+I
Sbjct: 301 FGAARNIEEGGSLTILATALVDTGSKMDEVIYEEFKGTGNMELHLDRKVAEKRVFPAMNI 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQ 422
            KSGTR+E+ LV   +LQK+++LR+++  M+   A+EFLID++KQTK N +FF SM ++
Sbjct: 361 RKSGTRREERLVSEDELQKMWILRKVLHPMDEIGAMEFLIDRMKQTKTNLEFFDSMKRK 419


>gi|261210409|ref|ZP_05924703.1| transcription termination factor Rho [Vibrio sp. RC341]
 gi|260840467|gb|EEX67033.1| transcription termination factor Rho [Vibrio sp. RC341]
          Length = 409

 Score =  575 bits (1481), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 274/408 (67%), Positives = 339/408 (83%)

Query: 15  TKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQDGFGFLRSPDAN 74
           + L+   ESL +EN   +RKQ+++F+ILK  +    +I G+GV+E+LQDGFGFLRS D++
Sbjct: 2   SDLVKLGESLGLENLARLRKQDIIFAILKAHAKSGEDIFGDGVLEILQDGFGFLRSADSS 61

Query: 75  YLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAINFDVPERVRNKI 134
           YLAGPDDIYVSPSQI+ F+L+TGD++ G IR P+EGERYFALLKVN +N D P+  RNKI
Sbjct: 62  YLAGPDDIYVSPSQIRRFNLRTGDSIAGKIRPPKEGERYFALLKVNTVNDDRPDNARNKI 121

Query: 135 HFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPPRTGKTILLQNI 194
            F+NLTPL+ ++R  ME  N   +DI++RV+DL APIGKGQR LIVAPP+ GKT+LLQNI
Sbjct: 122 LFENLTPLHANERMVMERGNGSTEDITARVLDLAAPIGKGQRGLIVAPPKAGKTMLLQNI 181

Query: 195 AHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHVQVAEMVIAKAK 254
           A SI  NHPEC L+VLLIDERPEEVT+MQR V+GEV++STFDE A+RHVQVAEMVI KAK
Sbjct: 182 AQSIASNHPECVLMVLLIDERPEEVTEMQRLVKGEVVASTFDEPASRHVQVAEMVIEKAK 241

Query: 255 CLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRFFGAARNIKEGG 314
            LVE+  DVVILLDSITRL RAYN ++P+SGK+LTGGVDANAL RPKRFFGAARN++EGG
Sbjct: 242 RLVEHKKDVVILLDSITRLARAYNTVVPASGKVLTGGVDANALHRPKRFFGAARNVEEGG 301

Query: 315 SLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDIIKSGTRKEDLL 374
           SLTII TALVDTGS+MDEVI+EEFKGTGN E+ L RKIA+KR+FPA+D  +SGTR+E+LL
Sbjct: 302 SLTIIATALVDTGSKMDEVIYEEFKGTGNMELHLNRKIAEKRVFPAIDFNRSGTRREELL 361

Query: 375 VERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQ 422
            +  +LQK+++LR+IV  M  SDA+EFLIDKL  TK N +FF +M +Q
Sbjct: 362 TKTDELQKMWILRKIVHPMGESDAMEFLIDKLAMTKTNDEFFDAMRRQ 409


>gi|116515296|ref|YP_802925.1| transcription termination factor Rho [Buchnera aphidicola str. Cc
           (Cinara cedri)]
 gi|58384656|gb|AAW72676.1| transcription termination factor rho [Buchnera aphidicola (Cinara
           cedri)]
 gi|116257150|gb|ABJ90832.1| transcription termination factor [Buchnera aphidicola str. Cc
           (Cinara cedri)]
          Length = 420

 Score =  575 bits (1481), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 273/418 (65%), Positives = 342/418 (81%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L +LKN S +KL+   E + +EN   MRKQ+++FSILK  S    +I G+GV+E+LQD
Sbjct: 1   MNLTKLKNTSVSKLIILGEKIGLENLARMRKQDIIFSILKQHSKSGEDIFGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P+EGERYFALLKVN +N
Sbjct: 61  GFGFLRSSDSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNKVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           +D PE  R+KI F+NLTPL+ + R  ME  N   +D+++RV+DL +PIG+GQR LIVAPP
Sbjct: 121 YDQPENARSKILFENLTPLHANSRLQMERGNGSKEDLTARVLDLASPIGRGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA SI  NHP+C L+VLLIDERPEEVT+MQR V GEV++STFDE A+RHV
Sbjct: 181 KAGKTMLLQNIAQSIAYNHPDCVLMVLLIDERPEEVTEMQRLVNGEVVASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI +AK LVE+  DV+ILLDSITRL RAYN ++P+SGK+LTGGVDANAL RPKRF
Sbjct: 241 QVAEMVIERAKRLVEHKKDVIILLDSITRLARAYNTVVPASGKVLTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN+KEGGSLTII TAL+DTGS+MDEVI+EEFKGTGN E+ L RKIA+KR+FPA+D 
Sbjct: 301 FGAARNVKEGGSLTIIATALIDTGSKMDEVIYEEFKGTGNMELPLSRKIAEKRVFPAIDY 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            +SGTR+E+LL   ++LQK+++LR+I+  M   DA+EFLI+KL  TK N +FF  M +
Sbjct: 361 NRSGTRREELLTVPEELQKMWILRKIIHPMGEIDAMEFLINKLSMTKTNNEFFNMMKR 418


>gi|262369829|ref|ZP_06063156.1| transcription termination factor Rho [Acinetobacter johnsonii
           SH046]
 gi|262314868|gb|EEY95908.1| transcription termination factor Rho [Acinetobacter johnsonii
           SH046]
          Length = 422

 Score =  575 bits (1481), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 274/419 (65%), Positives = 350/419 (83%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK K   +L+  AE + +E     RKQ+++F+ILK  +    EI G+GV+E+L D
Sbjct: 1   MNLTELKKKPIGELIKIAEFMGLEGMARNRKQDIIFAILKRHAMNGEEIFGDGVLEILSD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS   +YLAGPDDIYVSPSQI+ F+L+TGDT+ G+IR P+EGERYFALLKVN IN
Sbjct: 61  GFGFLRSAAGSYLAGPDDIYVSPSQIRRFNLRTGDTITGTIRPPKEGERYFALLKVNQIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           +D PE  RNKI F+NLTPL+P ++  MEL N   +D+++RV+DL+APIGKGQRS+IVAPP
Sbjct: 121 YDTPENSRNKILFENLTPLFPTEQLVMELGNGTTEDLTARVVDLVAPIGKGQRSIIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA SI +N+PEC+LIVLLIDERPEEVT+M+R+V+GEVI+STFDES ARHV
Sbjct: 181 KAGKTMLLQNIAQSIVRNNPECFLIVLLIDERPEEVTEMERTVRGEVIASTFDESPARHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDA+AL+RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVVPSSGKVLTGGVDAHALERPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TAL++TGS+MDEVI+EEFKGTGN EI L+R+IA+KR+FPAM+I
Sbjct: 301 FGAARNIEEGGSLTIISTALIETGSKMDEVIYEEFKGTGNQEITLDRRIAEKRVFPAMNI 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQ 422
            KSGTR+E+ L+   +L+KV++LR+++ + +   A+EFL+D++K+TK N DFF  M ++
Sbjct: 361 KKSGTRREERLMSEDNLRKVWILRKLLHTQDELAAMEFLLDRMKETKTNDDFFDQMKRK 419


>gi|119469630|ref|ZP_01612499.1| transcription termination factor Rho [Alteromonadales bacterium
           TW-7]
 gi|119446877|gb|EAW28148.1| transcription termination factor Rho [Alteromonadales bacterium
           TW-7]
          Length = 419

 Score =  574 bits (1480), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 275/419 (65%), Positives = 347/419 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L+ELK+KS  +L+  AES+ +EN   +RKQ+++F+ILK  +     I G GV+E+LQD
Sbjct: 1   MHLRELKDKSIKELVNLAESMGLENVARLRKQDIIFTILKSHAKGGENIFGGGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS +A+YLAGPDDIYVSPSQI+ FS++TGD++ G IR P++GERYFALLKVN +N
Sbjct: 61  GFGFLRSSEASYLAGPDDIYVSPSQIRRFSMRTGDSISGLIRPPKDGERYFALLKVNEVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           FD PE  R KI F+NLTPL+ ++RF ME  N   +DI++RV+DL +PIG+GQR L+VAPP
Sbjct: 121 FDKPENSRTKILFENLTPLHANERFRMERGNGSKEDITARVLDLASPIGRGQRGLLVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA SI  NHP+  L+VLLIDERPEEVT+MQR V+GEVI+STFDE A+RHV
Sbjct: 181 KAGKTMLLQNIAQSITHNHPDVTLMVLLIDERPEEVTEMQRLVKGEVIASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANAL +PKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVIPSSGKVLTGGVDANALHKPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TAL+DTGS+MDEVI+EEFKGTGN E+ L RKIA++R+FPA+D 
Sbjct: 301 FGAARNVEEGGSLTIIATALIDTGSKMDEVIYEEFKGTGNMELHLNRKIAERRVFPAIDF 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQ 422
            +SGTR+E+LL +  +LQK+++LR+IV  M+  DA+EFLIDKL  +K N +FF SM +Q
Sbjct: 361 NRSGTRREELLTKPDELQKLWILRKIVHEMSEIDAMEFLIDKLSMSKTNDEFFDSMKRQ 419


>gi|238918070|ref|YP_002931584.1| transcription termination factor Rho, [Edwardsiella ictaluri
           93-146]
 gi|269137458|ref|YP_003294158.1| transcription termination factor [Edwardsiella tarda EIB202]
 gi|238867638|gb|ACR67349.1| transcription termination factor Rho, putative [Edwardsiella
           ictaluri 93-146]
 gi|267983118|gb|ACY82947.1| transcription termination factor [Edwardsiella tarda EIB202]
 gi|304557532|gb|ADM40196.1| Transcription termination factor Rho [Edwardsiella tarda FL6-60]
          Length = 419

 Score =  574 bits (1480), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 272/418 (65%), Positives = 343/418 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELKN   ++L+   ES+ +EN   MRKQ+++F+ILK  +    +I G+GV+E+LQD
Sbjct: 1   MNLTELKNTPVSELITLGESMGLENLARMRKQDIIFAILKQHAKSGEDIFGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P+EGERYFALLKVN +N
Sbjct: 61  GFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNEVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           +D PE  R+KI F+NLTPL+ + R  ME  N   +D+++RV+DL +PIG+GQR LIVAPP
Sbjct: 121 YDKPENARSKILFENLTPLHANSRLRMERGNGSTEDLTARVLDLASPIGRGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA SI  NHP+C L+VLLIDERPEEVT+MQR V+GEV++STFDE A+RHV
Sbjct: 181 KAGKTMLLQNIAQSIAYNHPDCVLMVLLIDERPEEVTEMQRLVKGEVVASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DV+ILLDSITRL RAYN ++P+SGK+LTGGVDANAL RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVIILLDSITRLARAYNTVVPASGKVLTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TAL+DTGS+MDEVI+EEFKGTGN E+ L RKIA+KR+FPA+D 
Sbjct: 301 FGAARNVEEGGSLTIIATALIDTGSKMDEVIYEEFKGTGNMELHLSRKIAEKRVFPAIDY 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            +SGTRKE+LL   ++LQK+++LR+I+  M   DA+EFLI+KL  TK N +FF  M +
Sbjct: 361 NRSGTRKEELLTTPEELQKMWILRKIIHPMGEIDAMEFLINKLAMTKTNDEFFDMMKR 418


>gi|148266076|ref|YP_001232782.1| transcription termination factor Rho [Geobacter uraniireducens Rf4]
 gi|146399576|gb|ABQ28209.1| transcription termination factor Rho [Geobacter uraniireducens Rf4]
          Length = 415

 Score =  574 bits (1480), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 281/418 (67%), Positives = 344/418 (82%), Gaps = 3/418 (0%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M LQELK K   +L A A+ L IE A+ +RKQ+L+F+IL   + ++  I GEGV+E L D
Sbjct: 1   MNLQELKGKKINELTAIAKGLNIEGASSLRKQDLIFAILNAQTEKNGMIFGEGVLETLPD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLR+PD NYL GPDDIYVSPSQI+ F+L TGDTV G IR P+EGERYFALLKV ++N
Sbjct: 61  GFGFLRAPDYNYLPGPDDIYVSPSQIRRFNLHTGDTVSGQIRPPKEGERYFALLKVESVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
            + P+  R+KI FDNLTPLYP+++  +E   P+N  +  RV++LIAPIGKGQR LIVAPP
Sbjct: 121 HESPDVARDKILFDNLTPLYPEEKLKLE-TTPDN--MPMRVVELIAPIGKGQRGLIVAPP 177

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           RTGKT+L+QNIA+SI +NHPE +LIVLLIDERPEEVTDMQRSV GEVISSTFDE A+RH+
Sbjct: 178 RTGKTMLIQNIANSIAENHPEVFLIVLLIDERPEEVTDMQRSVNGEVISSTFDEPASRHI 237

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++P SGKIL+GGVD+NAL +PKRF
Sbjct: 238 QVAEMVIEKAKRLVEHKRDVVILLDSITRLARAYNTVIPPSGKILSGGVDSNALHKPKRF 297

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TALVDTGS+MDEVIFEEFKGTGN E+ L+RK+ +KR FPA+DI
Sbjct: 298 FGAARNIEEGGSLTIIATALVDTGSKMDEVIFEEFKGTGNMELHLDRKLVEKRTFPAIDI 357

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            KSGTRKE+LL+E+  L ++++LR+++  MN  D++EFLI KL+ TK N+ F  SM+K
Sbjct: 358 NKSGTRKEELLIEKSALNRIWILRKVLHPMNVVDSMEFLISKLEGTKGNQAFLDSMSK 415


>gi|22124276|ref|NP_667699.1| transcription termination factor Rho [Yersinia pestis KIM 10]
 gi|45442930|ref|NP_994469.1| transcription termination factor Rho [Yersinia pestis biovar
           Microtus str. 91001]
 gi|51594523|ref|YP_068714.1| transcription termination factor Rho [Yersinia pseudotuberculosis
           IP 32953]
 gi|108806149|ref|YP_650065.1| transcription termination factor Rho [Yersinia pestis Antiqua]
 gi|108810262|ref|YP_646029.1| transcription termination factor Rho [Yersinia pestis Nepal516]
 gi|145600735|ref|YP_001164811.1| transcription termination factor Rho [Yersinia pestis Pestoides F]
 gi|153947228|ref|YP_001399177.1| transcription termination factor Rho [Yersinia pseudotuberculosis
           IP 31758]
 gi|153997077|ref|ZP_02022210.1| transcription termination factor [Yersinia pestis CA88-4125]
 gi|162421255|ref|YP_001605108.1| transcription termination factor Rho [Yersinia pestis Angola]
 gi|165926348|ref|ZP_02222180.1| transcription termination factor Rho [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|165939680|ref|ZP_02228223.1| transcription termination factor Rho [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|166009660|ref|ZP_02230558.1| transcription termination factor Rho [Yersinia pestis biovar
           Antiqua str. E1979001]
 gi|166213582|ref|ZP_02239617.1| transcription termination factor Rho [Yersinia pestis biovar
           Antiqua str. B42003004]
 gi|167402066|ref|ZP_02307545.1| transcription termination factor Rho [Yersinia pestis biovar
           Antiqua str. UG05-0454]
 gi|167421074|ref|ZP_02312827.1| transcription termination factor Rho [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167425983|ref|ZP_02317736.1| transcription termination factor Rho [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|170026244|ref|YP_001722749.1| transcription termination factor Rho [Yersinia pseudotuberculosis
           YPIII]
 gi|186893521|ref|YP_001870633.1| transcription termination factor Rho [Yersinia pseudotuberculosis
           PB1/+]
 gi|218930870|ref|YP_002348745.1| transcription termination factor Rho [Yersinia pestis CO92]
 gi|229837200|ref|ZP_04457365.1| transcription termination factor [Yersinia pestis Pestoides A]
 gi|229839560|ref|ZP_04459719.1| transcription termination factor [Yersinia pestis biovar Orientalis
           str. PEXU2]
 gi|229900123|ref|ZP_04515260.1| transcription termination factor [Yersinia pestis biovar Orientalis
           str. India 195]
 gi|229900430|ref|ZP_04515559.1| transcription termination factor [Yersinia pestis Nepal516]
 gi|270488786|ref|ZP_06205860.1| transcription termination factor Rho [Yersinia pestis KIM D27]
 gi|294505530|ref|YP_003569592.1| transcription termination factor Rho [Yersinia pestis Z176003]
 gi|21957045|gb|AAM83950.1|AE013636_8 transcription termination factor Rho; polarity suppressor [Yersinia
           pestis KIM 10]
 gi|45437797|gb|AAS63346.1| transcription termination factor [Yersinia pestis biovar Microtus
           str. 91001]
 gi|51587805|emb|CAH19407.1| transcription termination factor [Yersinia pseudotuberculosis IP
           32953]
 gi|108773910|gb|ABG16429.1| transcription termination factor Rho [Yersinia pestis Nepal516]
 gi|108778062|gb|ABG12120.1| transcription termination factor Rho [Yersinia pestis Antiqua]
 gi|115349481|emb|CAL22454.1| transcription termination factor [Yersinia pestis CO92]
 gi|145212431|gb|ABP41838.1| transcription termination factor Rho [Yersinia pestis Pestoides F]
 gi|149289383|gb|EDM39461.1| transcription termination factor [Yersinia pestis CA88-4125]
 gi|152958723|gb|ABS46184.1| transcription termination factor Rho [Yersinia pseudotuberculosis
           IP 31758]
 gi|162354070|gb|ABX88018.1| transcription termination factor Rho [Yersinia pestis Angola]
 gi|165912370|gb|EDR31004.1| transcription termination factor Rho [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|165921872|gb|EDR39069.1| transcription termination factor Rho [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|165991582|gb|EDR43883.1| transcription termination factor Rho [Yersinia pestis biovar
           Antiqua str. E1979001]
 gi|166205255|gb|EDR49735.1| transcription termination factor Rho [Yersinia pestis biovar
           Antiqua str. B42003004]
 gi|166961203|gb|EDR57224.1| transcription termination factor Rho [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167048540|gb|EDR59948.1| transcription termination factor Rho [Yersinia pestis biovar
           Antiqua str. UG05-0454]
 gi|167055131|gb|EDR64930.1| transcription termination factor Rho [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|169752778|gb|ACA70296.1| transcription termination factor Rho [Yersinia pseudotuberculosis
           YPIII]
 gi|186696547|gb|ACC87176.1| transcription termination factor Rho [Yersinia pseudotuberculosis
           PB1/+]
 gi|229682449|gb|EEO78536.1| transcription termination factor [Yersinia pestis Nepal516]
 gi|229686903|gb|EEO78982.1| transcription termination factor [Yersinia pestis biovar Orientalis
           str. India 195]
 gi|229695926|gb|EEO85973.1| transcription termination factor [Yersinia pestis biovar Orientalis
           str. PEXU2]
 gi|229706143|gb|EEO92152.1| transcription termination factor [Yersinia pestis Pestoides A]
 gi|262363596|gb|ACY60317.1| transcription termination factor Rho [Yersinia pestis D106004]
 gi|262367524|gb|ACY64081.1| transcription termination factor Rho [Yersinia pestis D182038]
 gi|270337290|gb|EFA48067.1| transcription termination factor Rho [Yersinia pestis KIM D27]
 gi|294355989|gb|ADE66330.1| transcription termination factor Rho [Yersinia pestis Z176003]
 gi|320013532|gb|ADV97103.1| transcription termination factor [Yersinia pestis biovar Medievalis
           str. Harbin 35]
          Length = 419

 Score =  574 bits (1480), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 276/418 (66%), Positives = 339/418 (81%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELKN   + L+   E++ +EN   MRKQ+++FSILK  +    +I G+GV+E+LQD
Sbjct: 1   MNLTELKNTPVSDLITLGENMGLENLARMRKQDIIFSILKQHAKSGEDIFGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGDTV G IR P+EGERYFALLKVN +N
Sbjct: 61  GFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTVAGKIRPPKEGERYFALLKVNEVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           +D PE  RNKI F+NLTPL+ + R  ME  N   +D+++RV+DL +PIG+GQR LIVAPP
Sbjct: 121 YDKPENARNKILFENLTPLHANSRLRMERGNGSTEDLTARVLDLASPIGRGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA SI  NHP+C L+VLLIDERPEEVT+MQR V+GEVI+STFDE A+RHV
Sbjct: 181 KAGKTMLLQNIATSIAYNHPDCVLMVLLIDERPEEVTEMQRLVKGEVIASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DV+ILLDSITRL RAYN ++P+SGK+LTGGVDANAL RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVIILLDSITRLARAYNTVVPASGKVLTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TALVDTGS+MDEVI+EEFKGTGN E+ L RKIA+KR+FPA+D 
Sbjct: 301 FGAARNVEEGGSLTIIATALVDTGSKMDEVIYEEFKGTGNMELHLSRKIAEKRVFPAIDF 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            +SGTRKE+LL    +LQK+++LRRI+  M   DA+EFLI KL   K N  FF +M +
Sbjct: 361 NRSGTRKEELLTTTDELQKMWILRRILHPMGEIDAMEFLISKLATAKTNDQFFDNMRR 418


>gi|320354567|ref|YP_004195906.1| transcription termination factor Rho [Desulfobulbus propionicus DSM
           2032]
 gi|320123069|gb|ADW18615.1| transcription termination factor Rho [Desulfobulbus propionicus DSM
           2032]
          Length = 415

 Score =  574 bits (1480), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 277/418 (66%), Positives = 347/418 (83%), Gaps = 3/418 (0%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M   ELKNK   +L++ A SL IE  + M KQEL+F+ILK  +  D ++ G GV+E+LQD
Sbjct: 1   MNPTELKNKKIKELVSLAASLNIEGYSNMTKQELIFAILKEQADEDGKLRGSGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLR+PD NYL GPDDIYVSPSQI+  +L+TGD+VEG +RAP++ ERYFALLKV+ IN
Sbjct: 61  GFGFLRAPDYNYLPGPDDIYVSPSQIRRLNLRTGDSVEGEVRAPKDNERYFALLKVDTIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           +++PE  +NK  F NLTPL+PDK  N+E   P+N  +S RV+++ AP+GKGQR LIVAPP
Sbjct: 121 YELPEAAKNKTAFINLTPLHPDKLINLE-TTPDN--LSMRVLNITAPLGKGQRGLIVAPP 177

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           RTGKT+L+Q IA+SI  NH E  LIVLLIDERPEEVTDM+RSV  EV+SSTFDE   RH+
Sbjct: 178 RTGKTVLMQKIANSIVTNHKEIILIVLLIDERPEEVTDMKRSVDAEVVSSTFDEPPQRHI 237

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KA+ LVE+  DVVILLDSITRL RAYN + P+SGKIL+GGV+ANAL RPKRF
Sbjct: 238 QVAEMVIQKAQRLVEHKKDVVILLDSITRLARAYNTVTPASGKILSGGVEANALHRPKRF 297

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTI+ TAL+DTGSRMDEVIFEEFKGTGN EIVL+RK+A++RI+PA+DI
Sbjct: 298 FGAARNVEEGGSLTILATALIDTGSRMDEVIFEEFKGTGNMEIVLDRKMANRRIYPAIDI 357

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            KSGTRKEDLL+  +DL ++++LR+++SSMN +DA+EFL+DK+ QTK N++FF SMN+
Sbjct: 358 QKSGTRKEDLLLPPEDLNRIWILRKLLSSMNPADAMEFLLDKMSQTKTNQEFFASMNR 415


>gi|77359089|ref|YP_338664.1| transcription termination factor Rho [Pseudoalteromonas
           haloplanktis TAC125]
 gi|76874000|emb|CAI85221.1| transcription termination factor Rho; polarity suppressor
           [Pseudoalteromonas haloplanktis TAC125]
          Length = 419

 Score =  574 bits (1479), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 275/419 (65%), Positives = 347/419 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L+ELK+KS  +L+  AES+ +EN   +RKQ+++F+ILK  +     I G GV+E+LQD
Sbjct: 1   MHLRELKDKSIKELVDLAESMGLENVARLRKQDIIFAILKSHAKGGENIFGGGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS +A+YLAGPDDIYVSPSQI+ FS++TGD++ G IR P++GERYFALLKVN +N
Sbjct: 61  GFGFLRSSEASYLAGPDDIYVSPSQIRRFSMRTGDSISGLIRPPKDGERYFALLKVNEVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           FD PE  R KI F+NLTPL+ ++RF ME  N   +DI++RV+DL +PIG+GQR L+VAPP
Sbjct: 121 FDKPENSRTKILFENLTPLHANERFRMERGNGSKEDITARVLDLASPIGRGQRGLLVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA SI  NHP+  L+VLLIDERPEEVT+MQR V+GEVI+STFDE A+RHV
Sbjct: 181 KAGKTMLLQNIAQSITHNHPDATLMVLLIDERPEEVTEMQRLVKGEVIASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANAL +PKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVIPSSGKVLTGGVDANALHKPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TAL+DTGS+MDEVI+EEFKGTGN E+ L RKIA++R+FPA+D 
Sbjct: 301 FGAARNVEEGGSLTIIATALIDTGSKMDEVIYEEFKGTGNMELHLNRKIAERRVFPAIDF 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQ 422
            +SGTR+E+LL +  +LQK+++LR+IV  M+  DA+EFLIDKL  +K N +FF SM +Q
Sbjct: 361 NRSGTRREELLTKPDELQKLWILRKIVHDMSEIDAMEFLIDKLSMSKTNDEFFDSMKRQ 419


>gi|294637931|ref|ZP_06716200.1| transcription termination factor Rho [Edwardsiella tarda ATCC
           23685]
 gi|291088957|gb|EFE21518.1| transcription termination factor Rho [Edwardsiella tarda ATCC
           23685]
          Length = 453

 Score =  574 bits (1479), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 272/420 (64%), Positives = 344/420 (81%)

Query: 2   SEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVL 61
           + M L ELKN   ++L+   ES+ +EN   MRKQ+++F+ILK  +    +I G+GV+E+L
Sbjct: 33  TTMNLTELKNTPVSELITLGESMGLENLARMRKQDIIFAILKQHAKSGEDIFGDGVLEIL 92

Query: 62  QDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNA 121
           QDGFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P+EGERYFALLKVN 
Sbjct: 93  QDGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNE 152

Query: 122 INFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVA 181
           +N+D PE  R+KI F+NLTPL+ + R  ME  N   +D+++RV+DL +PIG+GQR LIVA
Sbjct: 153 VNYDKPENARSKILFENLTPLHANSRLRMERGNGSTEDLTARVLDLASPIGRGQRGLIVA 212

Query: 182 PPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAAR 241
           PP+ GKT+LLQNIA SI  NHP+C L+VLLIDERPEEVT+MQR V+GEV++STFDE A+R
Sbjct: 213 PPKAGKTMLLQNIAQSIAYNHPDCVLMVLLIDERPEEVTEMQRLVKGEVVASTFDEPASR 272

Query: 242 HVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPK 301
           HVQVAEMVI KAK LVE+  DV+ILLDSITRL RAYN ++P+SGK+LTGGVDANAL RPK
Sbjct: 273 HVQVAEMVIEKAKRLVEHKKDVIILLDSITRLARAYNTVVPASGKVLTGGVDANALHRPK 332

Query: 302 RFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAM 361
           RFFGAARN++EGGSLTII TAL+DTGS+MDEVI+EEFKGTGN E+ L RKIA+KR+FPA+
Sbjct: 333 RFFGAARNVEEGGSLTIIATALIDTGSKMDEVIYEEFKGTGNMELHLSRKIAEKRVFPAI 392

Query: 362 DIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
           D  +SGTRKE+LL   ++LQK+++LR+I+  M   DA+EFLI+KL  TK N +FF  M +
Sbjct: 393 DYNRSGTRKEELLTTPEELQKMWILRKIIHPMGEIDAMEFLINKLAMTKTNDEFFDMMKR 452


>gi|157368409|ref|YP_001476398.1| transcription termination factor Rho [Serratia proteamaculans 568]
 gi|270264232|ref|ZP_06192499.1| transcription termination factor rho [Serratia odorifera 4Rx13]
 gi|157320173|gb|ABV39270.1| transcription termination factor Rho [Serratia proteamaculans 568]
 gi|270041881|gb|EFA14978.1| transcription termination factor rho [Serratia odorifera 4Rx13]
          Length = 419

 Score =  574 bits (1479), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 274/418 (65%), Positives = 343/418 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELKN   ++L+   E++ +EN   MRKQ+++FSILK  +    +I G+GV+E+LQD
Sbjct: 1   MNLTELKNTPVSELITLGENMGLENLARMRKQDIIFSILKQHAKSGEDIFGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGD+V G IR P+EGERYFALLKVN +N
Sbjct: 61  GFGFLRSGDSSYLAGPDDIYVSPSQIRRFNLRTGDSVSGKIRPPKEGERYFALLKVNEVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           +D PE  R+KI F+NLTPL+ + R  ME  N   +D+++RV+DL +PIG+GQR LIVAPP
Sbjct: 121 YDKPENARSKILFENLTPLHANSRLRMERGNGSTEDLTARVLDLASPIGRGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA SI  NHP+C L+VLLIDERPEEVT+MQR V+GEVI+STFDE A+RHV
Sbjct: 181 KAGKTMLLQNIAQSIAYNHPDCVLMVLLIDERPEEVTEMQRLVKGEVIASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DV+ILLDSITRL RAYN ++P+SGK+LTGGVDANAL RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVIILLDSITRLARAYNTVVPASGKVLTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TALVDTGS+MDEVI+EEFKGTGN E+ L RKIA+KR+FPA+D 
Sbjct: 301 FGAARNVEEGGSLTIIATALVDTGSKMDEVIYEEFKGTGNMELHLARKIAEKRVFPAIDY 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            +SGTRKE+LL   ++LQK+++LR+I+  M   DA+EFLI+KL  TK N +FF  M +
Sbjct: 361 NRSGTRKEELLTTSEELQKMWILRKIIHPMGEIDAMEFLINKLAMTKTNDEFFDMMKR 418


>gi|332139980|ref|YP_004425718.1| transcription termination factor Rho [Alteromonas macleodii str.
           'Deep ecotype']
 gi|327550002|gb|AEA96720.1| transcription termination factor Rho [Alteromonas macleodii str.
           'Deep ecotype']
          Length = 421

 Score =  574 bits (1479), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 274/419 (65%), Positives = 341/419 (81%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELKNK  ++L+  AE + +EN    RKQ+++FSILK  +    +I G+GV+E+LQD
Sbjct: 1   MNLTELKNKPISELVNLAEEMGLENMARARKQDIIFSILKTHAKSGEDIFGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P++ ERYFALLK+  +N
Sbjct: 61  GFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTIAGKIRPPKDSERYFALLKIREVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           FD PE  RNKI F+NLTPL+   R  ME  N   +DI++RV+DL +PIGKGQR LIVAPP
Sbjct: 121 FDKPENSRNKILFENLTPLHAADRLRMERGNGSTEDITARVLDLASPIGKGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA SI  NHP+C L+VLLIDERPEEVT+M R VQGEV++STFDE A+RHV
Sbjct: 181 KAGKTLLLQNIAQSIAANHPDCELMVLLIDERPEEVTEMHRLVQGEVVASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANAL +PKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVIPSSGKVLTGGVDANALHKPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TAL+DTGS+MDEVI+EEFKGTGN E+ L RKIA+KR+FPA+D 
Sbjct: 301 FGAARNVEEGGSLTIIATALIDTGSKMDEVIYEEFKGTGNMELHLNRKIAEKRVFPAIDF 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQ 422
            +SGTR+E+LL  + +LQK+++LR+IV  M+  DA++FLI KL  TK N +FF +M +Q
Sbjct: 361 NRSGTRREELLTAQDELQKMWILRKIVHEMSEIDAMDFLISKLSMTKTNNEFFDAMRRQ 419


>gi|271502410|ref|YP_003335436.1| transcription termination factor Rho [Dickeya dadantii Ech586]
 gi|307133001|ref|YP_003885017.1| transcription termination factor [Dickeya dadantii 3937]
 gi|270345965|gb|ACZ78730.1| transcription termination factor Rho [Dickeya dadantii Ech586]
 gi|306530530|gb|ADN00461.1| transcription termination factor [Dickeya dadantii 3937]
          Length = 419

 Score =  574 bits (1479), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 271/418 (64%), Positives = 343/418 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELKN   ++L+   E++ +EN   MRKQ+++F+ILK  +    +I G+GV+E+LQD
Sbjct: 1   MNLTELKNTPVSELITLGENMGLENLARMRKQDIIFAILKQHAKSGEDIFGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P+EGERYFALLKVN +N
Sbjct: 61  GFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNEVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           +D PE  R+KI F+NLTPL+ + R  ME  N   +D+++RV+DL +PIG+GQR LIVAPP
Sbjct: 121 YDKPENARSKILFENLTPLHANSRLRMERGNGSTEDLTARVLDLASPIGRGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA SI  NHP+C L+VLLIDERPEEVT+MQR V+GEV++STFDE A+RHV
Sbjct: 181 KAGKTMLLQNIAQSIAYNHPDCVLMVLLIDERPEEVTEMQRLVKGEVVASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DV+ILLDSITRL RAYN ++P+SGK+LTGGVDANAL RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVIILLDSITRLARAYNTVVPASGKVLTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TAL+DTGS+MDEVI+EEFKGTGN E+ L RKIA+KR+FPA+D 
Sbjct: 301 FGAARNVEEGGSLTIIATALIDTGSKMDEVIYEEFKGTGNMELHLSRKIAEKRVFPAIDY 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            +SGTRKE+LL   ++LQK+++LR+I+  M   DA+EFLI+KL  TK N +FF  M +
Sbjct: 361 NRSGTRKEELLTTSEELQKMWILRKIIHPMGEIDAMEFLINKLAMTKTNDEFFDMMKR 418


>gi|300721426|ref|YP_003710697.1| transcription termination factor Rho; polarity suppressor
           [Xenorhabdus nematophila ATCC 19061]
 gi|297627914|emb|CBJ88460.1| transcription termination factor Rho; polarity suppressor
           [Xenorhabdus nematophila ATCC 19061]
          Length = 419

 Score =  574 bits (1479), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 274/418 (65%), Positives = 344/418 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELKN   ++L+   E++ +EN   MRKQ+++FSILK  +    +I G+GV+E+LQD
Sbjct: 1   MNLTELKNTPVSELITLGENMGLENLARMRKQDIIFSILKQHAKSGEDIFGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P+EGERYFALLKVN +N
Sbjct: 61  GFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNEVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           FD PE  R+KI F+NLTPL+ + R  ME  N   +D+++RV+DL APIG+GQR LIVAPP
Sbjct: 121 FDKPENARSKILFENLTPLHANNRLRMERGNGSTEDLTARVLDLAAPIGRGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA +I  N+P+C L+VLLIDERPEEVT+MQR V+GEVI+STFDE A+RHV
Sbjct: 181 KAGKTMLLQNIAANIAHNYPDCVLMVLLIDERPEEVTEMQRLVKGEVIASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DV+ILLDSITRL RAYN ++P+SGK+LTGGVDANAL RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVIILLDSITRLARAYNTVVPASGKVLTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TALVDTGS+MDEVI+EEFKGTGN E+ L RKIA+KR+FPA+D 
Sbjct: 301 FGAARNVEEGGSLTIIATALVDTGSKMDEVIYEEFKGTGNMELHLSRKIAEKRVFPAIDY 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            +SGTRKE+LL  + +LQK+++LR+I+  M   DA+EFLI+KL  TK N++FF  M +
Sbjct: 361 NRSGTRKEELLTTQDELQKMWILRKIIHPMGEIDAMEFLINKLAMTKTNEEFFDFMKR 418


>gi|260774366|ref|ZP_05883280.1| transcription termination factor Rho [Vibrio metschnikovii CIP
           69.14]
 gi|260610493|gb|EEX35698.1| transcription termination factor Rho [Vibrio metschnikovii CIP
           69.14]
          Length = 409

 Score =  574 bits (1479), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 274/408 (67%), Positives = 339/408 (83%)

Query: 15  TKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQDGFGFLRSPDAN 74
           + L+   ESL +EN   +RKQ+++F+ILK  +    +I G+GV+E+LQDGFGFLRS D++
Sbjct: 2   SDLVKLGESLGLENLARLRKQDIIFAILKAHAKGGEDIFGDGVLEILQDGFGFLRSADSS 61

Query: 75  YLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAINFDVPERVRNKI 134
           YLAGPDDIYVSPSQI+ F+L+TGD++ G IR P+EGERYFALLKVN +N D P+  RNKI
Sbjct: 62  YLAGPDDIYVSPSQIRRFNLRTGDSIAGKIRPPKEGERYFALLKVNTVNHDKPDNARNKI 121

Query: 135 HFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPPRTGKTILLQNI 194
            F+NLTPL+ ++R  ME  N   +DI++RV+DL APIGKGQR LIVAPP+ GKT+LLQNI
Sbjct: 122 LFENLTPLHANERMVMERGNGSTEDITARVLDLAAPIGKGQRGLIVAPPKAGKTMLLQNI 181

Query: 195 AHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHVQVAEMVIAKAK 254
           A SI  NHPEC L+VLLIDERPEEVT+MQR V+GEVI+STFDE A+RHVQVA+MVI KAK
Sbjct: 182 AQSIANNHPECVLMVLLIDERPEEVTEMQRLVKGEVIASTFDEPASRHVQVADMVIEKAK 241

Query: 255 CLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRFFGAARNIKEGG 314
            LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANAL RPKRFFGAARN++EGG
Sbjct: 242 RLVEHKKDVVILLDSITRLARAYNTVVPSSGKVLTGGVDANALHRPKRFFGAARNVEEGG 301

Query: 315 SLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDIIKSGTRKEDLL 374
           SLTII TALVDTGS+MDEVI+EEFKGTGN E+ L RKIA+KR+FPA+D  +SGTR+E+LL
Sbjct: 302 SLTIIATALVDTGSKMDEVIYEEFKGTGNMELHLNRKIAEKRVFPAIDFNRSGTRREELL 361

Query: 375 VERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQ 422
            +  +LQK+++LR+IV  M  +DA+EFLIDKL  TK N +FF +M +Q
Sbjct: 362 TKTDELQKMWILRKIVHPMGETDAMEFLIDKLAMTKTNDEFFDAMRRQ 409


>gi|118581063|ref|YP_902313.1| transcription termination factor Rho [Pelobacter propionicus DSM
           2379]
 gi|118503773|gb|ABL00256.1| transcription termination factor Rho [Pelobacter propionicus DSM
           2379]
          Length = 415

 Score =  574 bits (1479), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 279/418 (66%), Positives = 340/418 (81%), Gaps = 3/418 (0%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M LQELK K   +L A A  L IE A+ +RKQ+L+F+IL   + ++  I GEGV+E LQD
Sbjct: 1   MNLQELKGKKINELNAIARDLSIEGASSLRKQDLIFAILNAQTEQNGMIFGEGVLETLQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLR+ D NYL GPDDIYVSPSQI+ F+L+TGDTV G IR P+EGERYFALLKV ++N
Sbjct: 61  GFGFLRATDYNYLPGPDDIYVSPSQIRRFNLRTGDTVSGQIRPPKEGERYFALLKVESVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           F+ PE  R KI FDNLTPLYP+++  +E       ++  RV++L+APIGKGQR LIVAPP
Sbjct: 121 FESPEVAREKILFDNLTPLYPEEKLKLETGA---DNLPMRVVELMAPIGKGQRGLIVAPP 177

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           RTGKT+L+QNIA+SI  NHPE YLIVLLIDERPEEVTDMQRSV GEV+SSTFDE A RHV
Sbjct: 178 RTGKTMLIQNIANSIAANHPEVYLIVLLIDERPEEVTDMQRSVNGEVVSSTFDEPATRHV 237

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++P SGKIL+GGVD+NAL +PKRF
Sbjct: 238 QVAEMVIEKAKRLVEHKRDVVILLDSITRLARAYNTVIPPSGKILSGGVDSNALHKPKRF 297

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TALVDTGS+MDEVIFEEFKGTGN E+ L+RK+ +KR FPA+DI
Sbjct: 298 FGAARNIEEGGSLTIIATALVDTGSKMDEVIFEEFKGTGNMELHLDRKLVEKRTFPAIDI 357

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            KSGTRKE+LL+++  L ++++LR+++  MN  D++EFL+DKL + K N+ F  SM+K
Sbjct: 358 NKSGTRKEELLIDKNSLNRIWILRKVIHPMNVVDSMEFLLDKLSEAKTNQAFLDSMSK 415


>gi|330900035|gb|EGH31454.1| transcription termination factor Rho [Pseudomonas syringae pv.
           japonica str. M301072PT]
          Length = 419

 Score =  573 bits (1478), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 280/419 (66%), Positives = 344/419 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK K  T+LL  AE   IEN    RKQ+++FS+LK  +    EI G+GV+E+LQD
Sbjct: 1   MNLTELKQKPITELLEMAEQAGIENMARSRKQDVIFSLLKRHAKSGEEISGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS DA+YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P+EGERYFALLKV+ IN
Sbjct: 61  GFGFLRSADASYLAGPDDIYVSPSQIRRFNLRTGDTIVGKIRPPKEGERYFALLKVDTIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           +D PE  +NKI F+NLTPL+P  R  ME  N   +D++ RVIDL APIGKGQR LIVAPP
Sbjct: 121 YDRPENAKNKILFENLTPLFPTIRMKMEAGNGSTEDLTGRVIDLCAPIGKGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKTI+LQNIA +I +N+PE +LIVLLIDERPEEVT+MQR+V+GEV++STFDE   RHV
Sbjct: 181 KAGKTIMLQNIASNITRNNPEVHLIVLLIDERPEEVTEMQRTVRGEVVASTFDEPPTRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDA+AL++PKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVIPSSGKVLTGGVDAHALEKPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TALV+TGS+MDEVI+EEFKGTGN E+ L+RKIA+KR+FPA++I
Sbjct: 301 FGAARNIEEGGSLTIIATALVETGSKMDEVIYEEFKGTGNMELPLDRKIAEKRVFPAINI 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQ 422
            +SGTR+E+LL    +LQ++++LR +   M+   AIEFLIDKLKQTK N +FF SM ++
Sbjct: 361 NRSGTRREELLTADDELQRMWILRNLRHPMDEVAAIEFLIDKLKQTKTNDEFFLSMKRK 419


>gi|32491052|ref|NP_871306.1| transcription termination factor Rho [Wigglesworthia glossinidia
           endosymbiont of Glossina brevipalpis]
 gi|25166259|dbj|BAC24449.1| rho [Wigglesworthia glossinidia endosymbiont of Glossina
           brevipalpis]
          Length = 419

 Score =  573 bits (1478), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 273/418 (65%), Positives = 342/418 (81%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELKNK  + L+   E++ +EN   MRKQ+++FS LK  +    +I G+GV+E+LQD
Sbjct: 1   MNLTELKNKLISDLITLGENMGLENLARMRKQDIIFSTLKQHAKIGEDIFGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P+EGERYFALLKV+ +N
Sbjct: 61  GFGFLRSSDSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVDEVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           +D PE  RNKI F+NLTPL+ + R  ME  N   +D+++RV+DL APIG+GQR LIVAPP
Sbjct: 121 YDKPESSRNKILFENLTPLHANSRLKMERGNGSTEDLTTRVLDLAAPIGRGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA SI  NHP+C LIVLLIDERPEEVT+MQR V+GEVI+STFDE ++RHV
Sbjct: 181 KAGKTMLLQNIAQSISYNHPDCVLIVLLIDERPEEVTEMQRLVKGEVIASTFDEPSSRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QV+EMVI KAK LVE+  DV+ILLDSITRL RAYN ++P+SGK+LTGGVDANAL RPKRF
Sbjct: 241 QVSEMVIEKAKRLVEHKKDVIILLDSITRLARAYNTVVPASGKVLTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TAL+DTGS+MDEVI+EEFKGTGN E+ L RKIA+KR+FPA+D 
Sbjct: 301 FGAARNMEEGGSLTIIATALIDTGSKMDEVIYEEFKGTGNMELHLSRKIAEKRVFPAIDY 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            +SGTRKE+LL   ++LQK+++LRRI+  MN  D +EFL++KL  TK N +FF  M +
Sbjct: 361 NRSGTRKEELLTSSEELQKMWILRRIIHPMNEIDGMEFLMNKLSMTKTNNEFFDMMKR 418


>gi|239993251|ref|ZP_04713775.1| transcription termination factor Rho [Alteromonas macleodii ATCC
           27126]
          Length = 421

 Score =  573 bits (1478), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 274/419 (65%), Positives = 341/419 (81%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELKNK  ++L+  AE + +EN    RKQ+++FSILK  +    +I G+GV+E+LQD
Sbjct: 1   MNLTELKNKPISELVNLAEEMGLENMARARKQDIIFSILKTHAKSGEDIFGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P++ ERYFALLK+  +N
Sbjct: 61  GFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTIAGKIRPPKDSERYFALLKIREVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           FD PE  RNKI F+NLTPL+   R  ME  N   +DI++RV+DL +PIGKGQR LIVAPP
Sbjct: 121 FDKPENSRNKILFENLTPLHAADRLRMERGNGSTEDITARVLDLASPIGKGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA SI  NHP+C L+VLLIDERPEEVT+M R VQGEV++STFDE A+RHV
Sbjct: 181 KAGKTLLLQNIAQSIAANHPDCELMVLLIDERPEEVTEMHRLVQGEVVASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANAL +PKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVIPSSGKVLTGGVDANALHKPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TAL+DTGS+MDEVI+EEFKGTGN E+ L RKIA+KR+FPA+D 
Sbjct: 301 FGAARNVEEGGSLTIIATALIDTGSKMDEVIYEEFKGTGNMELHLNRKIAEKRVFPAIDF 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQ 422
            +SGTR+E+LL  + +LQK+++LR+IV  M+  DA++FLI KL  TK N +FF +M +Q
Sbjct: 361 NRSGTRREELLTAQDELQKMWILRKIVHEMSEIDAMDFLISKLSMTKTNDEFFDAMRRQ 419


>gi|262167972|ref|ZP_06035671.1| transcription termination factor Rho [Vibrio cholerae RC27]
 gi|262172591|ref|ZP_06040269.1| transcription termination factor Rho [Vibrio mimicus MB-451]
 gi|261893667|gb|EEY39653.1| transcription termination factor Rho [Vibrio mimicus MB-451]
 gi|262023505|gb|EEY42207.1| transcription termination factor Rho [Vibrio cholerae RC27]
 gi|327483177|gb|AEA77584.1| Transcription termination factor Rho [Vibrio cholerae LMA3894-4]
          Length = 409

 Score =  573 bits (1478), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 273/408 (66%), Positives = 339/408 (83%)

Query: 15  TKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQDGFGFLRSPDAN 74
           + L+   ESL +EN   +RKQ+++F+ILK  +    +I G+GV+E+LQDGFGFLRS D++
Sbjct: 2   SDLVKLGESLGLENLARLRKQDIIFAILKAHAKSGEDIFGDGVLEILQDGFGFLRSADSS 61

Query: 75  YLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAINFDVPERVRNKI 134
           YLAGPDDIYVSPSQI+ F+L+TGD++ G IR P+EGERYFALLKVN +N D P+  RNKI
Sbjct: 62  YLAGPDDIYVSPSQIRRFNLRTGDSIAGKIRPPKEGERYFALLKVNTVNDDRPDNARNKI 121

Query: 135 HFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPPRTGKTILLQNI 194
            F+NLTPL+ ++R  ME  N   +DI++RV+DL APIGKGQR LIVAPP+ GKT+LLQNI
Sbjct: 122 LFENLTPLHANERMVMERGNGSTEDITARVLDLAAPIGKGQRGLIVAPPKAGKTMLLQNI 181

Query: 195 AHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHVQVAEMVIAKAK 254
           A SI  NHPEC L+VLLIDERPEEVT+MQR V+GEV++STFDE A+RHVQVAEMVI KAK
Sbjct: 182 AQSIASNHPECVLMVLLIDERPEEVTEMQRLVKGEVVASTFDEPASRHVQVAEMVIEKAK 241

Query: 255 CLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRFFGAARNIKEGG 314
            LVE+  DVVILLDSITRL RAYN ++P+SGK+LTGGVDANAL RPKRFFGAARN++EGG
Sbjct: 242 RLVEHKKDVVILLDSITRLARAYNTVVPASGKVLTGGVDANALHRPKRFFGAARNVEEGG 301

Query: 315 SLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDIIKSGTRKEDLL 374
           SLTII TALVDTGS+MDEVI+EEFKGTGN E+ L RKIA+KR+FPA+D  +SGTR+E+LL
Sbjct: 302 SLTIIATALVDTGSKMDEVIYEEFKGTGNMELHLNRKIAEKRVFPAIDFNRSGTRREELL 361

Query: 375 VERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQ 422
            +  +LQK+++LR+IV  M  +DA+EFLIDKL  TK N +FF +M +Q
Sbjct: 362 TKTDELQKMWILRKIVHPMGETDAMEFLIDKLAMTKTNDEFFDAMRRQ 409


>gi|322434631|ref|YP_004216843.1| transcription termination factor Rho [Acidobacterium sp. MP5ACTX9]
 gi|321162358|gb|ADW68063.1| transcription termination factor Rho [Acidobacterium sp. MP5ACTX9]
          Length = 416

 Score =  573 bits (1478), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 273/417 (65%), Positives = 344/417 (82%), Gaps = 3/417 (0%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M + ELK  +  +L   A  L+I   + +RKQ+L+F IL+  S ++  I  EGV+E+L D
Sbjct: 1   MTISELKEHNIAELGKLARGLDIGGTSGLRKQDLIFKILQAQSEKEGHIFAEGVLEILPD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           G+GFLRSPD NYL GPDDIYVSPSQI+ F LKTGDT+ G++R+P EGE+YFAL+K+ AIN
Sbjct: 61  GYGFLRSPDYNYLPGPDDIYVSPSQIRKFDLKTGDTISGNVRSPHEGEKYFALVKIEAIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           F+ PE  RNK+ FDNLTPLY  +R  ME      + IS RV+DL+ P+GKGQR LIVAPP
Sbjct: 121 FESPEETRNKVLFDNLTPLYAQERVKMETVR---EHISGRVMDLLTPVGKGQRGLIVAPP 177

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           RTGKT+LLQ+IA+SI  NHPE  LIVLLIDERPEEVTDMQRSV+GEVISSTFDE AARHV
Sbjct: 178 RTGKTMLLQSIANSITANHPEVVLIVLLIDERPEEVTDMQRSVRGEVISSTFDEPAARHV 237

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++P SGK+L+GGVD+NALQRPKRF
Sbjct: 238 QVAEMVIEKAKRLVEHKRDVVILLDSITRLARAYNTIVPPSGKVLSGGVDSNALQRPKRF 297

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TALVDTGSRMDEVIFEEFKGTGN E++L+RK+ DKR+FPA+DI
Sbjct: 298 FGAARNIEEGGSLTIIATALVDTGSRMDEVIFEEFKGTGNMEVILDRKLVDKRVFPAIDI 357

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
            +SGTRKE+LL+ ++DLQ+ ++LR++++ ++ ++A+E L DKL +T++N++F ++M+
Sbjct: 358 QRSGTRKEELLIPKEDLQRTWILRKVLNPLSPTEAMELLTDKLAKTRNNQEFLHNMS 414


>gi|332534397|ref|ZP_08410237.1| transcription termination factor Rho [Pseudoalteromonas
           haloplanktis ANT/505]
 gi|332036131|gb|EGI72606.1| transcription termination factor Rho [Pseudoalteromonas
           haloplanktis ANT/505]
          Length = 419

 Score =  573 bits (1478), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 275/419 (65%), Positives = 347/419 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L+ELK+KS  +L+  AES+ +EN   +RKQ+++F+ILK  +     I G GV+E+LQD
Sbjct: 1   MHLRELKDKSIKELVDLAESMGLENVARLRKQDIIFAILKSHAKGGENIFGGGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS +A+YLAGPDDIYVSPSQI+ FS++TGD++ G IR P++GERYFALLKVN +N
Sbjct: 61  GFGFLRSSEASYLAGPDDIYVSPSQIRRFSMRTGDSISGLIRPPKDGERYFALLKVNEVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           FD PE  R KI F+NLTPL+ ++RF ME  N   +DI++RV+DL +PIG+GQR L+VAPP
Sbjct: 121 FDKPENSRTKILFENLTPLHANERFRMERGNGSKEDITARVLDLASPIGRGQRGLLVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA SI  NHP+  L+VLLIDERPEEVT+MQR V+GEVI+STFDE A+RHV
Sbjct: 181 KAGKTMLLQNIAQSITHNHPDVTLMVLLIDERPEEVTEMQRLVKGEVIASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANAL +PKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVIPSSGKVLTGGVDANALHKPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TAL+DTGS+MDEVI+EEFKGTGN E+ L RKIA++R+FPA+D 
Sbjct: 301 FGAARNVEEGGSLTIIATALIDTGSKMDEVIYEEFKGTGNMELHLNRKIAERRVFPAIDF 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQ 422
            +SGTR+E+LL +  +LQK+++LR+IV  M+  DA+EFLIDKL  +K N +FF SM +Q
Sbjct: 361 NRSGTRREELLTKPDELQKLWILRKIVHDMSEIDAMEFLIDKLSMSKTNDEFFDSMRRQ 419


>gi|311693125|gb|ADP95998.1| transcription termination factor rho [marine bacterium HP15]
          Length = 480

 Score =  573 bits (1478), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 276/420 (65%), Positives = 353/420 (84%), Gaps = 1/420 (0%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK KS  +LL  A+ + ++N    RKQ+++F+ILK  +    +I G+GV+E+LQD
Sbjct: 61  MNLTELKQKSVPELLDIAQEMGLDNLARSRKQDVIFTILKKHAKSGEDIYGDGVLEILQD 120

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS DA+YLAGPDDIYVSPSQI+ F+L+TGDTV G IR P++GERYFALLKV+ IN
Sbjct: 121 GFGFLRSADASYLAGPDDIYVSPSQIRRFNLRTGDTVAGKIRPPKDGERYFALLKVSEIN 180

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           FD P+  RNKI F+NLTPL+PD+R  +E  N   +D+SSRV+DL+APIGKGQR LIV+PP
Sbjct: 181 FDKPDNARNKILFENLTPLFPDERLMLEAGNGSTEDLSSRVLDLVAPIGKGQRGLIVSPP 240

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+L+Q+IA SI +N+PEC+++VLLIDERPEEVT+MQR+V+GEVI+STFDE  ARHV
Sbjct: 241 KAGKTLLMQSIAQSITRNNPECHVMVLLIDERPEEVTEMQRTVRGEVIASTFDEPPARHV 300

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDA+AL++PKRF
Sbjct: 301 QVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVIPSSGKVLTGGVDAHALEKPKRF 360

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTI+ TALV+TGS+MDEVI+EEFKGTGN EI L+RKIA+KR +PA++I
Sbjct: 361 FGAARNVEEGGSLTILATALVNTGSKMDEVIYEEFKGTGNMEIHLDRKIAEKRTYPAINI 420

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSM-NSSDAIEFLIDKLKQTKDNKDFFYSMNKQ 422
             SGTR+EDLL+   D+Q+V++LR+++ SM + + AIEFL+DKLK TK N +FF SM ++
Sbjct: 421 RSSGTRREDLLMSEADIQRVWILRKLLHSMDDDTAAIEFLLDKLKDTKTNDEFFQSMKRR 480


>gi|71278408|ref|YP_266944.1| transcription termination factor Rho [Colwellia psychrerythraea
           34H]
 gi|71144148|gb|AAZ24621.1| transcription termination factor Rho [Colwellia psychrerythraea
           34H]
          Length = 419

 Score =  573 bits (1477), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 275/419 (65%), Positives = 347/419 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK KS  +L+  A ++++EN    RKQ+++F+ILK  +  D +I G GV+E+LQD
Sbjct: 1   MNLTELKEKSINELVDLAATMKLENLARTRKQDIIFAILKAHAEGDNDIFGGGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ FS++TGDT++G IR+P++GERYFALLKV  +N
Sbjct: 61  GFGFLRSADSSYLAGPDDIYVSPSQIRRFSMRTGDTIQGKIRSPKKGERYFALLKVTEVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           FD PE  RNKI F+NLTP++P  RF++   N   +DI++R++DL +PIGKGQR LIVAPP
Sbjct: 121 FDRPENTRNKILFENLTPIHPTDRFSLARGNGSTEDITARILDLASPIGKGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA SI  N+P+  L+VLLIDERPEEVT+MQR V+GEVI+STFDE A+RHV
Sbjct: 181 KAGKTLLLQNIAQSIAHNNPDAELMVLLIDERPEEVTEMQRLVKGEVIASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGKILTGGVDANAL RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVIPSSGKILTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TALV+TGS+MDEVI+EEFKGTGN E+ L RKI++KR+FPA++I
Sbjct: 301 FGAARNIEEGGSLTIIATALVETGSKMDEVIYEEFKGTGNMELHLSRKISEKRVFPAINI 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQ 422
            +SGTR+E+L+ +  +LQK+++LR+IV  M+   AIEFLIDKL  TK N +FF SM ++
Sbjct: 361 NRSGTRREELITKPDELQKMWILRKIVHEMDEIGAIEFLIDKLAMTKTNDEFFDSMKRK 419


>gi|220933544|ref|YP_002512443.1| transcription termination factor Rho [Thioalkalivibrio sp.
           HL-EbGR7]
 gi|219994854|gb|ACL71456.1| transcription termination factor Rho [Thioalkalivibrio sp.
           HL-EbGR7]
          Length = 419

 Score =  573 bits (1477), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 273/418 (65%), Positives = 344/418 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK K   +L+  A+S++IE     RKQ+++F++LK  +    +I G+GV+E+LQD
Sbjct: 1   MNLTELKRKPAAELVELAQSMKIEGMARARKQDIIFAMLKAHAKNGEDIFGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ FSL+TGDT+ G IR P+EGERYFALLKV+ IN
Sbjct: 61  GFGFLRSGDSSYLAGPDDIYVSPSQIRRFSLRTGDTISGKIRPPKEGERYFALLKVDQIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           F+ PE  +NK+ F+NLTPL+  +R  ME  N   +DI++RVID++AP GKGQR LIV+PP
Sbjct: 121 FEAPENAKNKVLFENLTPLHASERMRMERGNGSTEDITARVIDIVAPFGKGQRGLIVSPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT++LQNIA SI  N+P+CYLIVLLIDERPEEVT+M R VQGEVISSTFDE A+RHV
Sbjct: 181 KAGKTLMLQNIAQSIATNYPDCYLIVLLIDERPEEVTEMARMVQGEVISSTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANAL RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKRDVVILLDSITRLARAYNTVVPSSGKVLTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTI+ TALVDTGS+MDEVI+EEFKGTGN EI L+R+IA+KR +PA++I
Sbjct: 301 FGAARNIEEGGSLTILATALVDTGSKMDEVIYEEFKGTGNMEIHLDRRIAEKRTYPAINI 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            +SGTR+E+LL +  +LQK+++LR+ + SM+  +AIEFL+ +L+ TK N +FF  M K
Sbjct: 361 NRSGTRREELLTDPDELQKLWILRKFLHSMDELEAIEFLLSRLQSTKVNSEFFDMMKK 418


>gi|295698458|ref|YP_003603113.1| transcription termination factor Rho [Candidatus Riesia
           pediculicola USDA]
 gi|291157244|gb|ADD79689.1| transcription termination factor Rho [Candidatus Riesia
           pediculicola USDA]
          Length = 419

 Score =  573 bits (1477), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 276/418 (66%), Positives = 341/418 (81%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L  LKNK  ++L+   E + +EN   MRKQ+++FSILK  +    +I G GV+E+LQD
Sbjct: 1   MNLTALKNKLVSELIVLGEKIGLENLARMRKQDIIFSILKQHAKSGEDIFGNGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P+EGERYFALLKVN +N
Sbjct: 61  GFGFLRSSDSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNEVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           FD PE  RNKI F+NLTPL+ + RF ME  N   +D+++RV+DL APIGKGQR LIVAPP
Sbjct: 121 FDKPENSRNKILFENLTPLHANIRFRMERGNGSTEDLTARVLDLAAPIGKGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKTILLQNIA +IK N+  C LIVLLIDERPEEVT+MQR V GEVI+STFDE A+RHV
Sbjct: 181 KAGKTILLQNIAANIKSNYSNCVLIVLLIDERPEEVTEMQRLVNGEVIASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QV+EMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGG+DANAL RPKRF
Sbjct: 241 QVSEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVIPSSGKVLTGGIDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN+KEGGSLTII TAL++TGS+MD+VI+EEFKGTGN E+ L R+I++KRIFPA+D 
Sbjct: 301 FGAARNVKEGGSLTIIATALIETGSKMDDVIYEEFKGTGNMELHLSRRISEKRIFPAIDY 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            +SGTRKE+LL  + +LQK+++LRRI+  M+  DA+EFLI+KL   K N++FF  M +
Sbjct: 361 NRSGTRKEELLTTKNELQKMWILRRIIHPMDEVDAMEFLINKLSMMKTNREFFEFMKR 418


>gi|119389950|pdb|2HT1|A Chain A, The Closed Ring Structure Of The Rho Transcription
           Termination Factor In Complex With Nucleic Acid In The
           Motor Domains
 gi|119389951|pdb|2HT1|B Chain B, The Closed Ring Structure Of The Rho Transcription
           Termination Factor In Complex With Nucleic Acid In The
           Motor Domains
          Length = 433

 Score =  573 bits (1476), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 271/413 (65%), Positives = 340/413 (82%)

Query: 2   SEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVL 61
             M L ELKN   ++L+   E++ +EN   MRKQ+++F+ILK  +    +I G+GV+E+L
Sbjct: 21  GHMNLTELKNTPVSELITLGENMGLENLARMRKQDIIFAILKQHAKSGEDIFGDGVLEIL 80

Query: 62  QDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNA 121
           QDGFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P+EGERYFALLKVN 
Sbjct: 81  QDGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNE 140

Query: 122 INFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVA 181
           +NFD PE  RNKI F+NLTPL+ + R  ME  N   +D+++RV+DL +PIG+GQR LIVA
Sbjct: 141 VNFDKPENARNKILFENLTPLHANSRLRMERGNGSTEDLTARVLDLASPIGRGQRGLIVA 200

Query: 182 PPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAAR 241
           PP+ GKT+LLQNIA SI  NHP+C L+VLLIDERPEEVT+MQR V+GEV++STFDE A+R
Sbjct: 201 PPKAGKTMLLQNIAQSIAYNHPDCVLMVLLIDERPEEVTEMQRLVKGEVVASTFDEPASR 260

Query: 242 HVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPK 301
           HVQVAEMVI KAK LVE+  DV+ILLDSITRL RAYN ++P+SGK+LTGGVDANAL RPK
Sbjct: 261 HVQVAEMVIEKAKRLVEHKKDVIILLDSITRLARAYNTVVPASGKVLTGGVDANALHRPK 320

Query: 302 RFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAM 361
           RFFGAARN++EGGSLTII TAL+DTGS+MDEVI+EEFKGTGN E+ L RKIA+KR+FPA+
Sbjct: 321 RFFGAARNVEEGGSLTIIATALIDTGSKMDEVIYEEFKGTGNMELHLSRKIAEKRVFPAI 380

Query: 362 DIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKD 414
           D  +SGTRKE+LL  +++LQK+++LR+I+  M   DA+EFLI+KL  TK N D
Sbjct: 381 DYNRSGTRKEELLTTQEELQKMWILRKIIHPMGEIDAMEFLINKLAMTKTNDD 433


>gi|126666611|ref|ZP_01737589.1| transcription termination factor Rho [Marinobacter sp. ELB17]
 gi|126628999|gb|EAZ99618.1| transcription termination factor Rho [Marinobacter sp. ELB17]
          Length = 410

 Score =  573 bits (1476), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 273/408 (66%), Positives = 347/408 (85%), Gaps = 1/408 (0%)

Query: 16  KLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQDGFGFLRSPDANY 75
           +LL  A+ + ++N    RKQ+++F+ILK  +    +I G+GV+E+LQDGFGFLRS DA+Y
Sbjct: 3   ELLEIAQEMGLDNLARSRKQDVIFTILKRHAKGGEDIYGDGVLEILQDGFGFLRSADASY 62

Query: 76  LAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAINFDVPERVRNKIH 135
           LAGPDDIYVSPSQI+ F+L+TGDTV G IR P++GERYFALLKV+ INFD P+  RNKI 
Sbjct: 63  LAGPDDIYVSPSQIRRFNLRTGDTVSGKIRPPKDGERYFALLKVSEINFDKPDNARNKIL 122

Query: 136 FDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPPRTGKTILLQNIA 195
           F+NLTPL+PD+R ++E  N   +D+SSRV+DL+APIGKGQR LIV+PP+ GKT+L+Q+IA
Sbjct: 123 FENLTPLFPDERMHLEAGNGSTEDLSSRVLDLVAPIGKGQRGLIVSPPKAGKTLLMQSIA 182

Query: 196 HSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHVQVAEMVIAKAKC 255
            SI +NHPEC++IVLLIDERPEEVT+MQR+V+GEVI+STFDE  ARHVQVAEMVI KAK 
Sbjct: 183 QSITRNHPECHIIVLLIDERPEEVTEMQRTVRGEVIASTFDEPPARHVQVAEMVIEKAKR 242

Query: 256 LVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRFFGAARNIKEGGS 315
           LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDA+AL++PKRFFGAARN++EGGS
Sbjct: 243 LVEHKKDVVILLDSITRLARAYNTVIPSSGKVLTGGVDAHALEKPKRFFGAARNVEEGGS 302

Query: 316 LTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDIIKSGTRKEDLLV 375
           LTI+ TALV+TGS+MDEVI+EEFKGTGN EI L+RKIA+KR +PA++I  SGTR+EDLL+
Sbjct: 303 LTILATALVNTGSKMDEVIYEEFKGTGNMEIHLDRKIAEKRTYPAINIRGSGTRREDLLM 362

Query: 376 ERQDLQKVFMLRRIVSSM-NSSDAIEFLIDKLKQTKDNKDFFYSMNKQ 422
              D+QKV++LR+++ SM + + AIEFL+DKLK TK N DFF SM ++
Sbjct: 363 SEADIQKVWILRKLLHSMDDDTAAIEFLLDKLKDTKTNDDFFQSMKRR 410


>gi|330951206|gb|EGH51466.1| transcription termination factor Rho [Pseudomonas syringae Cit 7]
          Length = 419

 Score =  573 bits (1476), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 279/419 (66%), Positives = 345/419 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK K  T+LL  AE   IEN    RKQ+++FS+LK  +    EI G+GV+E+LQD
Sbjct: 1   MNLTELKQKPITELLEMAEQAGIENMARSRKQDVIFSLLKRHAKSGEEISGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS DA+YLAGPDDIYV PSQI+ F+L+TGDT+ G IR P+EGERYFALLKV+ IN
Sbjct: 61  GFGFLRSADASYLAGPDDIYVLPSQIRRFNLRTGDTIVGKIRPPKEGERYFALLKVDTIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           +D PE  +NKI F+NLTPL+P  R  ME  N   +D++ RVIDL APIGKGQR LIVAPP
Sbjct: 121 YDRPENAKNKILFENLTPLFPTIRMKMEAGNGSPEDLTGRVIDLCAPIGKGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKTI+LQNIA +I +N+PE +LIVLLIDERPEEVT+MQR+V+GEV++STFDE   RHV
Sbjct: 181 KAGKTIMLQNIASNITRNNPEVHLIVLLIDERPEEVTEMQRTVRGEVVASTFDEPPTRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDA+AL++PKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVIPSSGKVLTGGVDAHALEKPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TALV+TGS+MDEVI+EEFKGTGN E+ L+RKIA+KR+FPA++I
Sbjct: 301 FGAARNIEEGGSLTIIATALVETGSKMDEVIYEEFKGTGNMELPLDRKIAEKRVFPAINI 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQ 422
            +SGTR+E+LL    +LQ++++LR+++  M+   AIEFLIDKLKQTK N +FF SM ++
Sbjct: 361 NRSGTRREELLTADDELQRMWILRKLLHPMDEVAAIEFLIDKLKQTKTNDEFFLSMKRK 419


>gi|42521712|ref|NP_967092.1| transcription termination factor Rho [Bdellovibrio bacteriovorus
           HD100]
 gi|39574242|emb|CAE77746.1| transcription termination factor Rho [Bdellovibrio bacteriovorus
           HD100]
          Length = 581

 Score =  572 bits (1475), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 275/419 (65%), Positives = 348/419 (83%), Gaps = 3/419 (0%)

Query: 2   SEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVL 61
           S +  ++LK+K+ T+L   A  L+IENA  +R+Q+++F ILK  +    +I G GV+E+L
Sbjct: 163 SWLSSKDLKSKNITQLTELANKLKIENAAGLRRQDMIFEILKRAAKLGQDIYGSGVLEIL 222

Query: 62  QDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNA 121
            DG+GFLRSPD NYL GPDDIYVSPSQI+ F L+TGDTV G++R P++GERYFALLKV++
Sbjct: 223 PDGYGFLRSPDYNYLPGPDDIYVSPSQIRRFGLRTGDTVTGTVRPPKDGERYFALLKVDS 282

Query: 122 INFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVA 181
           +NF+  E+ ++KI FDNLTPLYP++R  +E N  E    ++RV+DL+AP+GKGQR+LIVA
Sbjct: 283 LNFETTEKGKDKILFDNLTPLYPNERLKLEHNPGE---YTTRVVDLMAPLGKGQRALIVA 339

Query: 182 PPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAAR 241
           PPRTGKT+L+Q IA++I  NHPE  LIVLLIDERPEEVTDMQR+V+GEV+SSTFDE   R
Sbjct: 340 PPRTGKTVLMQQIANAITHNHPEVKLIVLLIDERPEEVTDMQRTVKGEVVSSTFDEPPTR 399

Query: 242 HVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPK 301
           HVQVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++P SGKIL+GGVD+NAL +PK
Sbjct: 400 HVQVAEMVIEKAKRLVEHKHDVVILLDSITRLARAYNTVVPPSGKILSGGVDSNALHKPK 459

Query: 302 RFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAM 361
           RFFGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGN+EI L+RK+ +KRIFP M
Sbjct: 460 RFFGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNAEIHLDRKLMEKRIFPCM 519

Query: 362 DIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           DI KSGTRKEDLLV++ DL ++++LR++++ MN  DA+EFLIDK++ TK N DF  +M+
Sbjct: 520 DINKSGTRKEDLLVDKADLNRLWILRKVLAPMNVIDAMEFLIDKVEGTKTNNDFLKAMS 578


>gi|257455704|ref|ZP_05620933.1| transcription termination factor Rho [Enhydrobacter aerosaccus
           SK60]
 gi|257446987|gb|EEV22001.1| transcription termination factor Rho [Enhydrobacter aerosaccus
           SK60]
          Length = 422

 Score =  572 bits (1475), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 272/420 (64%), Positives = 347/420 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK KS  +LL  +E + +EN    RKQ+++F+ILK  +     I G+GV+E+L D
Sbjct: 1   MNLTELKKKSIAELLLISEQMGLENMARSRKQDIIFAILKTHARNGEAIYGDGVLEILPD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS + +YLAGPDDIYVSPSQI+ F+LKTGD++ G+IR P++ ERYFALLKVN IN
Sbjct: 61  GFGFLRSSEGSYLAGPDDIYVSPSQIRRFNLKTGDSIAGTIRPPKDSERYFALLKVNEIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           FD P+R R+K+ F+NLTPL+P ++  +EL N   +D++ R+IDLIAPIGKGQRS+IVAPP
Sbjct: 121 FDTPDRSRHKLIFENLTPLFPTQQLRLELGNGTTEDLTGRIIDLIAPIGKGQRSIIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQ+IA SI KN+PECYLIVLLIDERPEEVT+MQR+V+GEV++STFDE  ARHV
Sbjct: 181 KAGKTVLLQSIAQSITKNNPECYLIVLLIDERPEEVTEMQRTVRGEVVASTFDEPPARHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANAL+RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKQDVVILLDSITRLARAYNTVLPSSGKVLTGGVDANALERPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TAL+DTGS MD+VI+EEFKGTGN EI LER IA+KR+FPA++I
Sbjct: 301 FGAARNVEEGGSLTIISTALIDTGSTMDKVIYEEFKGTGNQEITLERDIAEKRVFPAINI 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQN 423
            KSGTR+E+ L++   L+KV++LR+++  M+   A EFL++KLK +K N +FF  M +++
Sbjct: 361 KKSGTRREERLMDEAMLRKVWILRKLLHPMDELQATEFLLEKLKDSKTNDEFFEQMTRKD 420


>gi|293393866|ref|ZP_06638173.1| transcription termination factor rho [Serratia odorifera DSM 4582]
 gi|291423693|gb|EFE96915.1| transcription termination factor rho [Serratia odorifera DSM 4582]
          Length = 419

 Score =  572 bits (1475), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 271/418 (64%), Positives = 343/418 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELKN   ++L+   E++ +EN   +RKQ+++FSILK  +    +I G+GV+E+LQD
Sbjct: 1   MNLTELKNTPVSELITLGENMGLENLARLRKQDIIFSILKQHAKSGEDIFGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P+EGERYFALLKVN +N
Sbjct: 61  GFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTIAGKIRPPKEGERYFALLKVNEVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           +D PE  R+KI F+NLTPL+ + R  ME  N   +D+++RV+DL +PIG+GQR LIVAPP
Sbjct: 121 YDKPENARSKILFENLTPLHANSRLRMERGNGSTEDLTARVLDLASPIGRGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA +I  NHP+C L+VLLIDERPEEVT+MQR V+GEV++STFDE A+RHV
Sbjct: 181 KAGKTMLLQNIAQNIAYNHPDCVLMVLLIDERPEEVTEMQRLVKGEVVASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DV+ILLDSITRL RAYN ++P+SGK+LTGGVDANAL RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVIILLDSITRLARAYNTVVPASGKVLTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TALVDTGS+MDEVI+EEFKGTGN E+ L RKIA+KR+FPA+D 
Sbjct: 301 FGAARNVEEGGSLTIIATALVDTGSKMDEVIYEEFKGTGNMELHLARKIAEKRVFPAIDY 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            +SGTRKE+LL   ++LQK+++LR+I+  M   DA+EFLI+KL  TK N +FF  M +
Sbjct: 361 NRSGTRKEELLTTSEELQKMWILRKIIHPMGEIDAMEFLINKLAMTKTNDEFFDMMKR 418


>gi|304414182|ref|ZP_07395550.1| transcription termination factor [Candidatus Regiella insecticola
           LSR1]
 gi|304283396|gb|EFL91792.1| transcription termination factor [Candidatus Regiella insecticola
           LSR1]
          Length = 460

 Score =  572 bits (1475), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 275/418 (65%), Positives = 339/418 (81%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELKN    +L+   E + +EN    RKQ+++FSILK  +    +I G+GV+E+LQD
Sbjct: 42  MNLTELKNIPVHELIKLGEEMNLENLARTRKQDIIFSILKQHAKSGEDISGDGVLEILQD 101

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P+EGERYFALLKVN +N
Sbjct: 102 GFGFLRSGDSSYLAGPDDIYVSPSQIRRFNLRTGDTIAGKIRPPKEGERYFALLKVNEVN 161

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           +D PE  RNKI F+NLTPL+P+ R  ME  N   +D+++RV+DL APIG+GQR LIVAPP
Sbjct: 162 YDKPENSRNKILFENLTPLHPNSRLRMERGNGSTEDVTARVLDLAAPIGRGQRGLIVAPP 221

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA SI  NHP+C L+VLLIDERPEEVT+MQR V+GEVI+STFDE A+RHV
Sbjct: 222 KAGKTMLLQNIATSIAHNHPDCVLMVLLIDERPEEVTEMQRLVKGEVIASTFDEPASRHV 281

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DV+ILLDSITRL RAYN ++P+SGK+LTGGVDANAL RPKRF
Sbjct: 282 QVAEMVIEKAKRLVEHKKDVIILLDSITRLARAYNTVVPASGKVLTGGVDANALHRPKRF 341

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGA RN++EGGSLTII TALVDTGS+MDEVI+EEFKGTGN E+ L RKIA+KR+FPA+D 
Sbjct: 342 FGAGRNVEEGGSLTIIATALVDTGSKMDEVIYEEFKGTGNLELHLSRKIAEKRVFPAIDY 401

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            +SGTRKE+LL    +LQK+++LR+I+  M   DA+EFLI+KL  TK N +FF  M +
Sbjct: 402 NRSGTRKEELLSTSDELQKMWILRKIIQPMGEIDAMEFLINKLSMTKTNDEFFNMMKR 459


>gi|284006575|emb|CBA71836.1| transcription termination factor [Arsenophonus nasoniae]
          Length = 419

 Score =  572 bits (1474), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 276/418 (66%), Positives = 342/418 (81%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELKN   ++L+   ES+ +EN   MRKQ+++FSILK  +    +I G+GV+E+LQD
Sbjct: 1   MNLTELKNTPVSELITLGESMGLENLARMRKQDIIFSILKQHAKSGEDIFGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P+EGERYFALLKVN +N
Sbjct: 61  GFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNEVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           FD PE  R+KI F+NLTPL+ + R  ME  N   +D+++RV+DL APIG+GQR LIVAPP
Sbjct: 121 FDKPENARSKILFENLTPLHANNRLRMERGNGSTEDLTARVLDLAAPIGRGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA +I  N+P+C L+VLLIDERPEEVT+MQR V+GEVI+STFDE A+RHV
Sbjct: 181 KAGKTMLLQNIAANIANNYPDCVLMVLLIDERPEEVTEMQRLVKGEVIASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DV+ILLDSITRL RAYN ++PSSGK+LTGGVDANAL RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVIILLDSITRLARAYNTVVPSSGKVLTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TALVDTGS+MDEVI+EEFKGTGN E+ L RKIA+KR+FPA+D 
Sbjct: 301 FGAARNVEEGGSLTIIATALVDTGSKMDEVIYEEFKGTGNMELHLSRKIAEKRVFPAIDY 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            +SGTRKE+LL    +LQK+++LR+I+  M   DA+EFLI+KL  TK N +FF  M +
Sbjct: 361 NRSGTRKEELLTLPDELQKMWILRKIIHPMGEIDAMEFLINKLAMTKTNDEFFDFMKR 418


>gi|114319529|ref|YP_741212.1| transcription termination factor Rho [Alkalilimnicola ehrlichii
           MLHE-1]
 gi|114225923|gb|ABI55722.1| transcription termination factor Rho [Alkalilimnicola ehrlichii
           MLHE-1]
          Length = 418

 Score =  572 bits (1474), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 273/418 (65%), Positives = 346/418 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK K   +L+  A+ L +E     RKQ+++FSILK  +     I G+GV+E+LQD
Sbjct: 1   MNLTELKQKPAAELMKLAQELGVEGTARSRKQDVIFSILKSQAKGGEPIYGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++Y+AGPDDIYVSPSQI+ F+L+TGDT+ G IR P++GERYFALLKVN IN
Sbjct: 61  GFGFLRSADSSYMAGPDDIYVSPSQIRRFALRTGDTIAGKIRPPKDGERYFALLKVNEIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           F+ PE  ++K+ F+NLTPL+  +R  ME  N   +D+++R+IDLIAPIGKGQR L+V+PP
Sbjct: 121 FEPPENAKHKVLFENLTPLHATERMRMERGNGSTEDLTARIIDLIAPIGKGQRGLLVSPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQ+IA SI  NHPE YLIVLLIDERPEEVT+MQRSV+GEV+SSTFDE A+RHV
Sbjct: 181 KAGKTMLLQHIAQSITANHPETYLIVLLIDERPEEVTEMQRSVRGEVVSSTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANAL RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVVPSSGKVLTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSL+II T+LVDTGSRMDEVI+EEFKGTGN E+ L+R+I++KRI+PA++I
Sbjct: 301 FGAARNVEEGGSLSIIATSLVDTGSRMDEVIYEEFKGTGNMELHLDRRISEKRIYPAVNI 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            +SGTR+E+LL++  +LQKV++LR+++  M+   AIEFL+DKLK TK N +FF SM +
Sbjct: 361 NRSGTRREELLMKPDELQKVWILRKLLHPMDDLAAIEFLLDKLKDTKTNGEFFDSMKR 418


>gi|323143044|ref|ZP_08077749.1| transcription termination factor Rho [Succinatimonas hippei YIT
           12066]
 gi|322417185|gb|EFY07814.1| transcription termination factor Rho [Succinatimonas hippei YIT
           12066]
          Length = 419

 Score =  572 bits (1474), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 271/418 (64%), Positives = 340/418 (81%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L +LKN    +L+   +   IEN   + K+E++F +LK+ +    +I GEGVIE+L D
Sbjct: 1   MNLTQLKNTPVAQLVEMCDQAGIENTARLNKKEIIFQLLKLCARTGEDIFGEGVIEILPD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQ++ F+L+TGD++ G IR P+EGERYFALLKV++IN
Sbjct: 61  GFGFLRSADSSYLAGPDDIYVSPSQVRRFNLRTGDSISGKIRPPKEGERYFALLKVDSIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           ++ PE  RNKI F+NLTPL+ D R  +EL N   +DI++RVIDL APIGKGQR LIVAPP
Sbjct: 121 YEKPENARNKILFENLTPLFADTRMRLELGNGSKEDITARVIDLTAPIGKGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIAHSI  N+PEC LIVLLIDERPEEVT+MQR V+GEV++STFDE A RHV
Sbjct: 181 KAGKTMLLQNIAHSIAVNNPECTLIVLLIDERPEEVTEMQRMVKGEVVASTFDEPATRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVIL+DSITRL RAYN ++P+SGK+LTGGVDANALQRPKR 
Sbjct: 241 QVAEMVIEKAKRLVEHKHDVVILMDSITRLARAYNTVVPASGKVLTGGVDANALQRPKRL 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TAL+DTGS+MDEVI+EEFKGTGN E+ L RKIA+KR++PA+D+
Sbjct: 301 FGAARNVEEGGSLTIIATALIDTGSKMDEVIYEEFKGTGNMELHLSRKIAEKRVYPAIDV 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            +SGTR+E+LL    +LQK+++LR+ V  M   +A+EFLIDKL  TK N+ FF +M +
Sbjct: 361 TRSGTRREELLTTPDELQKMWILRKFVHPMGEIEAMEFLIDKLSMTKTNEQFFEAMKR 418


>gi|256823806|ref|YP_003147769.1| transcription termination factor Rho [Kangiella koreensis DSM
           16069]
 gi|256797345|gb|ACV28001.1| transcription termination factor Rho [Kangiella koreensis DSM
           16069]
          Length = 418

 Score =  572 bits (1474), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 278/418 (66%), Positives = 342/418 (81%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK KS   L   A+++ +++   MRKQ+++F +LK  +    +I G GV+E+L D
Sbjct: 1   MNLTELKQKSAQDLSEMAKAVGLDHMARMRKQDIIFGLLKNHAKSGEDIFGGGVLEILPD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS + +YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P++GERYFALLKV  IN
Sbjct: 61  GFGFLRSAEGSYLAGPDDIYVSPSQIRRFNLRTGDTIFGKIRPPKDGERYFALLKVAEIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           +D PE  RNK+ F+NLTPL+PD+R  ME  N   +DI++RVIDL APIGKGQR LIV+PP
Sbjct: 121 YDSPENSRNKLLFENLTPLHPDERIRMERGNGSTEDITARVIDLAAPIGKGQRGLIVSPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT++LQNIA SI  N+PEC LIVLLIDERPEEVT+MQRSV+GEV++STFDE AARHV
Sbjct: 181 KAGKTMILQNIAQSITSNNPECMLIVLLIDERPEEVTEMQRSVKGEVVASTFDEPAARHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DV+ILLDSITRL RAYN ++PSSGK+LTGGVDANALQRPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVIILLDSITRLARAYNTVVPSSGKVLTGGVDANALQRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TALVDTGS+MDEVI+EEFKGTGN E+ L RKI++KR+FPA+D 
Sbjct: 301 FGAARNIEEGGSLTIIATALVDTGSKMDEVIYEEFKGTGNMELHLSRKISEKRVFPAIDF 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            +SGTRKEDLL   ++LQK ++LR+I+  M+  DAIEFLIDK+  TK N +FF +M +
Sbjct: 361 NRSGTRKEDLLTSPEELQKNWILRKILHPMDEIDAIEFLIDKIALTKTNDEFFDAMKR 418


>gi|87120293|ref|ZP_01076188.1| transcription termination factor Rho [Marinomonas sp. MED121]
 gi|86164396|gb|EAQ65666.1| transcription termination factor Rho [Marinomonas sp. MED121]
          Length = 421

 Score =  572 bits (1474), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 274/416 (65%), Positives = 347/416 (83%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK KS  +LL  A  + I+N +  RKQ+++F+ILK  +    +I G+G++E+LQD
Sbjct: 1   MNLTELKQKSVQELLNIAAEMGIDNLSRSRKQDVIFAILKRHAKSGEDIYGDGILEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSPD++YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P++GERYFALLKVN IN
Sbjct: 61  GFGFLRSPDSSYLAGPDDIYVSPSQIRRFNLRTGDTIAGKIRPPKDGERYFALLKVNEIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           FD P+ VRNKI F+NLTPL+ D+R  ME  N   +D++SR+IDL+AP+GKGQR+L+V+PP
Sbjct: 121 FDKPDSVRNKILFENLTPLFADQRLVMEAGNGSTEDVTSRIIDLVAPMGKGQRALVVSPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT +LQNIA++I +N+PE  LIVLLIDERPEEVT+M R+V+GEV++STFDE  +RHV
Sbjct: 181 KAGKTFMLQNIANAITRNNPETDLIVLLIDERPEEVTEMTRTVRGEVVASTFDEPPSRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANAL+RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKRDVVILLDSITRLARAYNTVIPSSGKVLTGGVDANALERPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TALVDTGS+MDEVIFEEFKGTGN E+ L+RKIA+KR FPA++I
Sbjct: 301 FGAARNIEEGGSLTIIATALVDTGSKMDEVIFEEFKGTGNCELHLDRKIAEKRTFPAINI 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSM 419
            +SGTR+EDLL    +LQ++++LR++++ M    A EFLID+LK TK N +FF +M
Sbjct: 361 RRSGTRREDLLTSEDELQRMWILRKLLNPMEDVAATEFLIDRLKVTKTNDEFFDAM 416


>gi|297568587|ref|YP_003689931.1| transcription termination factor Rho [Desulfurivibrio alkaliphilus
           AHT2]
 gi|296924502|gb|ADH85312.1| transcription termination factor Rho [Desulfurivibrio alkaliphilus
           AHT2]
          Length = 421

 Score =  572 bits (1474), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 279/419 (66%), Positives = 348/419 (83%), Gaps = 6/419 (1%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLS---GRDVEIIGEGVIEV 60
           M + ELK K   +L + A+S+ IE    MRKQEL+F+IL+  S   G++ +  G GV+EV
Sbjct: 1   MNIGELKRKKIAELTSIAKSMNIEGYAGMRKQELIFAILQHQSAAQGKNGDNYGGGVLEV 60

Query: 61  LQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVN 120
           L DGFGFLR+PD NYL GPDDIYVSPSQI+  +L+TGDTVEG +R P+EGERYFALLKV+
Sbjct: 61  LPDGFGFLRAPDYNYLPGPDDIYVSPSQIRRLNLRTGDTVEGPVRFPKEGERYFALLKVD 120

Query: 121 AINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIV 180
            +NFD PE+ R+K  F NLTPL+P++R N+E  +P N   S+R++D++APIGKGQR LIV
Sbjct: 121 RVNFDPPEKSRDKTLFSNLTPLHPNERLNLE-RDPAN--FSTRIMDMMAPIGKGQRGLIV 177

Query: 181 APPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAA 240
           APPRTGKT+L+ +IA+SI KNHPE  LIVLLIDERPEEVTDM RSV  EVISSTFDE   
Sbjct: 178 APPRTGKTVLITDIANSITKNHPEVILIVLLIDERPEEVTDMARSVNAEVISSTFDEPPQ 237

Query: 241 RHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRP 300
           RH+QVAEMV+ KA+ LVE+  DVVILLDSITRL RAYN ++P SGKIL+GGVD+NAL RP
Sbjct: 238 RHIQVAEMVLDKARRLVEHQKDVVILLDSITRLARAYNTVVPPSGKILSGGVDSNALHRP 297

Query: 301 KRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPA 360
           KRFFGAARNI+EGGSLTII +AL++TGSRMD+VIFEEFKGTGN E+VL+RK+AD+RIFP+
Sbjct: 298 KRFFGAARNIEEGGSLTIIASALIETGSRMDDVIFEEFKGTGNMELVLDRKLADRRIFPS 357

Query: 361 MDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSM 419
           +DI KSGTRKEDLL+  +D+ K+++LR+++SSMN  DA+EFL+DK+K+TK N+DFF SM
Sbjct: 358 IDITKSGTRKEDLLLSAEDMNKIWILRKLLSSMNPVDAMEFLLDKMKRTKTNEDFFASM 416


>gi|21672828|ref|NP_660895.1| transcription termination factor Rho [Buchnera aphidicola str. Sg
           (Schizaphis graminum)]
 gi|22654270|sp|O51891|RHO_BUCAP RecName: Full=Transcription termination factor Rho; AltName:
           Full=ATP-dependent helicase Rho
 gi|21623481|gb|AAM68106.1| transcription termination factor Rho [Buchnera aphidicola str. Sg
           (Schizaphis graminum)]
          Length = 419

 Score =  572 bits (1474), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 272/418 (65%), Positives = 342/418 (81%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L  LKN   ++L+   E + +EN   MRKQ+++F+ILK  +    +I G+GV+E+LQD
Sbjct: 1   MNLTALKNMPVSELITLGEKMGLENLARMRKQDIIFAILKQHAKSGEDIFGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P+EGERYFALLKVNA+N
Sbjct: 61  GFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNAVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           +D PE  R+KI F+NLTPL+ + R  ME  N   +D+++RV+DL +PIG+GQR LIVAPP
Sbjct: 121 YDKPENARSKILFENLTPLHANSRLRMERGNGSTEDLTARVLDLASPIGRGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKTILLQNIA SI  NHP+C L+VLLIDERPEEVT+MQR V+GEV++STFDE A+RHV
Sbjct: 181 KAGKTILLQNIAQSIAYNHPDCVLMVLLIDERPEEVTEMQRLVKGEVVASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DV+ILLDSITRL RAYN ++P+SGK+LTGGVDANAL RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVIILLDSITRLARAYNTVVPASGKVLTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TALVDTGS+MDEVI+EEFKGTGN E+ L RKIA+KR+FPA+D 
Sbjct: 301 FGAARNVEEGGSLTIIATALVDTGSKMDEVIYEEFKGTGNMELPLSRKIAEKRVFPAIDY 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            +SGTRKE+LL    +LQK+++LR+I+  M+  DA+EFL++KL  TK N +FF  M +
Sbjct: 361 NRSGTRKEELLTLPDELQKMWILRKIIHPMSEIDAMEFLLNKLSMTKTNDEFFDMMKR 418


>gi|212213529|ref|YP_002304465.1| transcription termination factor Rho [Coxiella burnetii CbuG_Q212]
 gi|212011939|gb|ACJ19320.1| transcription termination factor rho [Coxiella burnetii CbuG_Q212]
          Length = 418

 Score =  572 bits (1473), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 272/416 (65%), Positives = 347/416 (83%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L +LK KS  +L+  A+ + +E  +  RKQ+++F++LK  + +  +I G+GV+E+LQD
Sbjct: 1   MNLTDLKQKSVPELMQIAQEMNLEYVSRTRKQDIIFAVLKAHAKKGEDIFGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGDTV G IR P+E ERYFALL+VN IN
Sbjct: 61  GFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTVSGKIRPPKESERYFALLQVNEIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
            + PE  + KI F+NLTPL+P+++ +ME  N   +DI++R+IDLI+PIGKGQR LIV+PP
Sbjct: 121 LEKPEASKGKILFENLTPLFPNEQISMETGNGSTEDITARIIDLISPIGKGQRGLIVSPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT++LQNIAHSI  NHPEC LIVLLIDERPEEVT+M RSV+GEV++STFDE A+RHV
Sbjct: 181 KAGKTMMLQNIAHSITTNHPECVLIVLLIDERPEEVTEMDRSVKGEVVASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++P+SGK+LTGGVDANALQRPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVIPASGKVLTGGVDANALQRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TALV+TGS+MD+VI+EEFKGTGN EI L+R+IA+KR FPA++I
Sbjct: 301 FGAARNVEEGGSLTIIATALVETGSKMDDVIYEEFKGTGNMEIHLDRRIAEKRTFPAINI 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSM 419
            +SGTR+E+L++ +  LQKV++LR+I+  M+   A EFLID+LK TK N DFF SM
Sbjct: 361 NRSGTRREELMMPQDVLQKVWILRKILHPMDELAASEFLIDRLKLTKTNNDFFDSM 416


>gi|157273418|gb|ABV27317.1| transcription termination factor Rho [Candidatus
           Chloracidobacterium thermophilum]
          Length = 440

 Score =  572 bits (1473), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 274/406 (67%), Positives = 340/406 (83%), Gaps = 3/406 (0%)

Query: 15  TKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQDGFGFLRSPDAN 74
           ++L+  A+ LE+ +A+ +RKQEL+F IL+  + R   I  EGV+E L DGFGFLR+PD N
Sbjct: 37  SELVRIAQELEVPSASSLRKQELVFKILQAQTERSGLIFSEGVLECLPDGFGFLRAPDYN 96

Query: 75  YLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAINFDVPERVRNKI 134
           YL GPDDIYVSPSQI+ F L+TGDT+ G IR P+EGERYFAL+KV AIN++ P+  R ++
Sbjct: 97  YLPGPDDIYVSPSQIRKFDLRTGDTISGQIRPPKEGERYFALIKVEAINYEPPDLRRERV 156

Query: 135 HFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPPRTGKTILLQNI 194
           HFDNLTPLYP+KR  ME + P+N  +S R++DLI PIG+GQR LIVAPPRTGKT+LLQ+I
Sbjct: 157 HFDNLTPLYPNKRLRME-STPDN--LSGRILDLITPIGRGQRGLIVAPPRTGKTMLLQSI 213

Query: 195 AHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHVQVAEMVIAKAK 254
           A+SI +NHPE  LIVLLIDERPEEVTDMQRSVQGEVISSTFDE   RHVQVA+MVI KAK
Sbjct: 214 ANSISRNHPEVMLIVLLIDERPEEVTDMQRSVQGEVISSTFDEPPTRHVQVADMVIEKAK 273

Query: 255 CLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRFFGAARNIKEGG 314
            LVE+G DVVILLDS+TRL RA+N  +P SGKIL+GGVDANALQ+PKRFFGAARN++EGG
Sbjct: 274 RLVEHGRDVVILLDSLTRLARAHNATVPPSGKILSGGVDANALQKPKRFFGAARNLEEGG 333

Query: 315 SLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDIIKSGTRKEDLL 374
           SLTII TAL+DTGSRMD+VIFEEFKGTGN EI L+RK+ +KRIFPA+DI KSGTRKE+LL
Sbjct: 334 SLTIIATALIDTGSRMDDVIFEEFKGTGNMEIHLDRKLVEKRIFPAVDINKSGTRKEELL 393

Query: 375 VERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           V ++DL ++F+LRR++S ++S +++E +I  L++TK N +F  SMN
Sbjct: 394 VPKEDLNRIFVLRRVLSPLSSVESMELMISHLERTKTNAEFLASMN 439


>gi|330872821|gb|EGH06970.1| transcription termination factor Rho [Pseudomonas syringae pv.
           glycinea str. race 4]
          Length = 413

 Score =  572 bits (1473), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 278/413 (67%), Positives = 342/413 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK K  T+LL  AE   IEN    RKQ+++FS+LK  +    EI G+GV+E+LQD
Sbjct: 1   MNLTELKQKPITELLEMAEQAGIENMARSRKQDVIFSLLKRHAKSGEEISGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS DA+YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P+EGERYFALLKV+ IN
Sbjct: 61  GFGFLRSADASYLAGPDDIYVSPSQIRRFNLRTGDTIVGKIRPPKEGERYFALLKVDTIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           +D PE  +NKI F+NLTPL+P  R  ME  N   +D++ RVIDL APIGKGQR LIVAPP
Sbjct: 121 YDRPENAKNKILFENLTPLFPTIRMKMEAGNGSTEDLTGRVIDLCAPIGKGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKTI+LQNIA +I +N+PE +LIVLLIDERPEEVT+MQR+V+GEV++STFDE   RHV
Sbjct: 181 KAGKTIMLQNIASNITRNNPEVHLIVLLIDERPEEVTEMQRTVRGEVVASTFDEPPTRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDA+AL++PKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVIPSSGKVLTGGVDAHALEKPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TALV+TGS+MDEVI+EEFKGTGN E+ L+RKIA+KR+FPA++I
Sbjct: 301 FGAARNIEEGGSLTIIATALVETGSKMDEVIYEEFKGTGNMELPLDRKIAEKRVFPAINI 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFF 416
            +SGTR+E+LL    +LQ++++LR+++  M+   AIEFLIDKLKQTK N +FF
Sbjct: 361 NRSGTRREELLTADDELQRMWILRKLLHPMDEVAAIEFLIDKLKQTKTNDEFF 413


>gi|29655364|ref|NP_821056.1| transcription termination factor Rho [Coxiella burnetii RSA 493]
 gi|153206897|ref|ZP_01945715.1| transcription termination factor Rho [Coxiella burnetii 'MSU Goat
           Q177']
 gi|154707044|ref|YP_001425486.1| transcription termination factor Rho [Coxiella burnetii Dugway
           5J108-111]
 gi|161830205|ref|YP_001597820.1| transcription termination factor Rho [Coxiella burnetii RSA 331]
 gi|212219583|ref|YP_002306370.1| transcription termination factor Rho [Coxiella burnetii CbuK_Q154]
 gi|29542636|gb|AAO91570.1| transcription termination factor rho [Coxiella burnetii RSA 493]
 gi|120576970|gb|EAX33594.1| transcription termination factor Rho [Coxiella burnetii 'MSU Goat
           Q177']
 gi|154356330|gb|ABS77792.1| transcription termination factor rho [Coxiella burnetii Dugway
           5J108-111]
 gi|161762072|gb|ABX77714.1| transcription termination factor Rho [Coxiella burnetii RSA 331]
 gi|212013845|gb|ACJ21225.1| transcription termination factor rho [Coxiella burnetii CbuK_Q154]
          Length = 418

 Score =  571 bits (1472), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 272/416 (65%), Positives = 346/416 (83%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L +LK KS  +L+  A+ + +E  +  RKQ+++F++LK  + +  +I G+GV+E+LQD
Sbjct: 1   MNLTDLKQKSVPELMQIAQEMNLEYVSRTRKQDIIFAVLKAHAKKGEDIFGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGDTV G IR P+E ERYFALL+VN IN
Sbjct: 61  GFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTVSGKIRPPKESERYFALLQVNEIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
            + PE  + KI F+NLTPL+P+++  ME  N   +DI++R+IDLI+PIGKGQR LIV+PP
Sbjct: 121 LEKPEASKGKILFENLTPLFPNEQIRMETGNGSTEDITARIIDLISPIGKGQRGLIVSPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT++LQNIAHSI  NHPEC LIVLLIDERPEEVT+M RSV+GEV++STFDE A+RHV
Sbjct: 181 KAGKTMMLQNIAHSITTNHPECVLIVLLIDERPEEVTEMDRSVKGEVVASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++P+SGK+LTGGVDANALQRPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVIPASGKVLTGGVDANALQRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TALV+TGS+MD+VI+EEFKGTGN EI L+R+IA+KR FPA++I
Sbjct: 301 FGAARNVEEGGSLTIIATALVETGSKMDDVIYEEFKGTGNMEIHLDRRIAEKRTFPAINI 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSM 419
            +SGTR+E+L++ +  LQKV++LR+I+  M+   A EFLID+LK TK N DFF SM
Sbjct: 361 NRSGTRREELMMPQDVLQKVWILRKILHPMDELAASEFLIDRLKLTKTNNDFFDSM 416


>gi|262281023|ref|ZP_06058806.1| transcription termination factor Rho [Acinetobacter calcoaceticus
           RUH2202]
 gi|262257923|gb|EEY76658.1| transcription termination factor Rho [Acinetobacter calcoaceticus
           RUH2202]
          Length = 422

 Score =  571 bits (1471), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 273/419 (65%), Positives = 350/419 (83%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK K   +L+  AE + +E     RKQ+++F+ILK  +    EI G+GV+E+L D
Sbjct: 1   MNLTELKKKPIGELIKIAEFMGLEGMARNRKQDIIFAILKRHAMNGEEIFGDGVLEILSD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS   +YLAGPDDIYVSPSQI+ F+L+TGDT+ G+IR P+EGERYFALLKVN IN
Sbjct: 61  GFGFLRSAAGSYLAGPDDIYVSPSQIRRFNLRTGDTITGTIRPPKEGERYFALLKVNQIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           +D PE  RNKI F+NLTPL+P ++  MEL N   +D++SRV+DL+APIGKGQRS+IVAPP
Sbjct: 121 YDTPENSRNKILFENLTPLFPTEQLVMELGNGTTEDLTSRVVDLVAPIGKGQRSIIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA SI +N+PE +LIVLLIDERPEEVT+M+R+V+GEVI+STFDE+ ARHV
Sbjct: 181 KAGKTMLLQNIAQSIVRNNPEVFLIVLLIDERPEEVTEMERTVRGEVIASTFDEAPARHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDA+AL+RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVIPSSGKVLTGGVDAHALERPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TAL++TGS+MD+VI+EEFKGTGN EI L+R+IA+KR+FPAM+I
Sbjct: 301 FGAARNIEEGGSLTIISTALIETGSKMDDVIYEEFKGTGNQEITLDRRIAEKRVFPAMNI 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQ 422
            KSGTR+E+ L++  +L+KV++LR+++  M+   A+EFL+D++K+TK N DFF  M ++
Sbjct: 361 KKSGTRREERLMDDDNLRKVWILRKLLHPMDELAAMEFLLDRMKETKTNDDFFDQMKRK 419


>gi|49088308|gb|AAT51555.1| PA5239 [synthetic construct]
          Length = 420

 Score =  571 bits (1471), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 274/419 (65%), Positives = 349/419 (83%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK K   +LL  ++++ +EN    RKQ+++F++LK  +    EI G+GV+E+LQD
Sbjct: 1   MNLTELKQKPIAELLEMSDAMGLENMARSRKQDIIFALLKKHAKSGEEISGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P+ GERYFALLKV++IN
Sbjct: 61  GFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTIIGKIRPPKGGERYFALLKVDSIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           FD PE  +NKI F+NLTPL+P++R  ME  N   +D++ RVIDL APIGKGQR LIVAP 
Sbjct: 121 FDRPENAKNKILFENLTPLFPNERMKMEAGNGSTEDLTGRVIDLCAPIGKGQRGLIVAPL 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKTI+LQNIA +I +N+PEC+LIVLLIDERPEEVT+MQR+V+GEV++STFDE   RHV
Sbjct: 181 KAGKTIMLQNIASNITRNNPECHLIVLLIDERPEEVTEMQRTVRGEVVASTFDEPPTRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDA+AL++PKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVIPSSGKVLTGGVDAHALEKPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTI+ TALV+TGS+MDEVI+EEFKGTGN E+ L+RKIA+KR+FPA++I
Sbjct: 301 FGAARNIEEGGSLTILATALVETGSKMDEVIYEEFKGTGNMELPLDRKIAEKRVFPAINI 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQ 422
            +SGTR+E+LL    +LQ++++LR+I+  M+   AIEFLIDKLKQTK N +FF SM ++
Sbjct: 361 NRSGTRREELLTSEDELQRMWILRKILHPMDEISAIEFLIDKLKQTKTNDEFFDSMKRK 419


>gi|119946796|ref|YP_944476.1| transcription termination factor Rho [Psychromonas ingrahamii 37]
 gi|119865400|gb|ABM04877.1| transcription termination factor Rho [Psychromonas ingrahamii 37]
          Length = 422

 Score =  571 bits (1471), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 269/419 (64%), Positives = 347/419 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK+   + L+   ES+ +EN   +RKQ+++F+ILK  +    +I G GV+E+LQD
Sbjct: 1   MNLTELKDTPVSNLVTLGESMGLENLARLRKQDIIFAILKAHAKSGEDIFGAGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS +++YLAGPDDIY+SPSQI+ F+L+TGD+V+G IR P++GERYFALLK+  +N
Sbjct: 61  GFGFLRSSESSYLAGPDDIYISPSQIRRFNLRTGDSVDGKIRPPKDGERYFALLKIIEVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           F+ PE  RNKI F+NLTP++PD+RF +E  N   +DI++R++DL++PIGKGQR LIVAPP
Sbjct: 121 FNKPENSRNKILFENLTPIHPDERFRLENGNGSTEDITARILDLVSPIGKGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA S+  N+PE  LIVLLIDERPEEVT+M R V+GEV++STFDE A+RHV
Sbjct: 181 KAGKTMLLQNIAQSLSINYPEAVLIVLLIDERPEEVTEMSRLVRGEVVASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVVPSSGKVLTGGVDANALQRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTI+ TAL+DTGS+MDEVI+EEFKGTGNSEI L RK+A+KR++PA+DI
Sbjct: 301 FGAARNVEEGGSLTILATALIDTGSKMDEVIYEEFKGTGNSEIHLNRKLAEKRVYPAIDI 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQ 422
            +SGTR+E+LL +  +LQ++++LR+IV  M  + A EFLIDKL  +K+N DFF +M  Q
Sbjct: 361 TRSGTRREELLTKSDELQRMWILRKIVHPMGETGATEFLIDKLGLSKNNDDFFDAMKNQ 419


>gi|119776349|ref|YP_929089.1| transcription termination factor Rho [Shewanella amazonensis SB2B]
 gi|119768849|gb|ABM01420.1| transcription termination factor Rho [Shewanella amazonensis SB2B]
          Length = 420

 Score =  570 bits (1470), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 276/418 (66%), Positives = 338/418 (80%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELKN S   L+A AES+ +EN    RKQ+++FSILK  +    +I G GV+E+LQD
Sbjct: 1   MNLNELKNMSIADLVALAESMNLENMARARKQDIIFSILKAHAKSGEDIFGGGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D +YLAGPDDIYVSPSQ++ F+L+TGDT+ G IR P+EGERYFALLKVN +N
Sbjct: 61  GFGFLRSADGSYLAGPDDIYVSPSQVRRFNLRTGDTIAGKIRPPKEGERYFALLKVNEVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           FD PE  RNKI F+NLTPL+ ++R  ME  N   +DI++R++DL +PIGKGQR LIVAPP
Sbjct: 121 FDKPEISRNKILFENLTPLHAEERLRMERGNGSTEDITARILDLCSPIGKGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA SI  N+PE  L+VLLIDERPEEVT+MQR V GEVI+STFDE A+RHV
Sbjct: 181 KAGKTMLLQNIAQSISYNNPEVVLMVLLIDERPEEVTEMQRLVHGEVIASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANAL RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVVPSSGKVLTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+ GGSLTII TAL+DTGS+MDEVI+EEFKGTGN E+ L RK A+KR+FPA+D 
Sbjct: 301 FGAARNIENGGSLTIIATALIDTGSKMDEVIYEEFKGTGNQELHLSRKAAEKRVFPAIDF 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            +SGTR+E+ L    +LQK+++LR+I++ M+   A+EFLIDKL  TK N +FF +M +
Sbjct: 361 NRSGTRREEKLTTSDELQKMWILRKILNPMDEVAAMEFLIDKLAMTKTNDEFFTAMKR 418


>gi|329297881|ref|ZP_08255217.1| transcription termination factor Rho [Plautia stali symbiont]
          Length = 419

 Score =  570 bits (1470), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 271/418 (64%), Positives = 343/418 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L +LKN   + L+   E++ +EN   MRKQ+++F+ILK  +    +I G+GV+E+LQD
Sbjct: 1   MNLTKLKNTPVSALITLGENMGLENLARMRKQDIIFAILKQHAKSGEDIFGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P+EGERYFALLKVN +N
Sbjct: 61  GFGFLRSGDSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNEVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           +D PE  R+KI F+NLTPL+ + R  ME  N   +D+++RV+DL +PIG+GQR LIVAPP
Sbjct: 121 YDKPENARSKILFENLTPLHANNRLRMERGNGSTEDLTARVLDLASPIGRGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA SI  N+P+C L+VLLIDERPEEVT+MQR V+GEVI+STFDE A+RHV
Sbjct: 181 KAGKTMLLQNIAQSIAYNYPDCVLMVLLIDERPEEVTEMQRLVKGEVIASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DV+ILLDSITRL RAYN ++P+SGK+LTGGVDANAL RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVIILLDSITRLARAYNTVVPASGKVLTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TALVDTGS+MDEVI+EEFKGTGN E+ L RKIA+KR+FPA+D 
Sbjct: 301 FGAARNVEEGGSLTIIATALVDTGSKMDEVIYEEFKGTGNMELHLSRKIAEKRVFPAIDY 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            +SGTRKE+LL  +++LQK+++LR+I+  M   DA+EFLI+KL  TK N +FF  M +
Sbjct: 361 NRSGTRKEELLTSQEELQKMWILRKIIHPMGEIDAMEFLINKLAMTKTNDEFFDMMKR 418


>gi|71892351|ref|YP_278085.1| transcription termination factor Rho [Candidatus Blochmannia
           pennsylvanicus str. BPEN]
 gi|71796457|gb|AAZ41208.1| transcription termination factor Rho [Candidatus Blochmannia
           pennsylvanicus str. BPEN]
          Length = 419

 Score =  570 bits (1469), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 271/418 (64%), Positives = 341/418 (81%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L +LKN   ++L+   ES+ +EN   MRKQ+++F+I K  +    +I G+GV+E+LQD
Sbjct: 1   MNLTKLKNIPVSELVHLGESMGLENLARMRKQDIIFAIFKQHAKTGEDIFGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P+EGERYFALLKVN +N
Sbjct: 61  GFGFLRSSDSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNDVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           +D PE  RNKI F+NLTPL+ + R  ME  N   +D+++RV+DL +PIG+GQR LIVAPP
Sbjct: 121 YDKPENARNKILFENLTPLHANSRLRMERGNGSTEDLTARVLDLASPIGRGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKTILLQNIA SI  NHP+C  IVLLIDERPEEVT+MQR V GEVI+STFDE A+RHV
Sbjct: 181 KAGKTILLQNIAQSISHNHPDCVSIVLLIDERPEEVTEMQRLVHGEVIASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QV+EMVI KAK LVE+  DV+ILLDSITRL RAYN ++PSSGK+LTGGVDANAL RPKRF
Sbjct: 241 QVSEMVIEKAKRLVEHKKDVIILLDSITRLARAYNTIVPSSGKVLTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TAL+DTGS+MDEVI+EEFKGTGN E+ L RKIA+KR+FPA+D 
Sbjct: 301 FGAARNMEEGGSLTIIATALIDTGSKMDEVIYEEFKGTGNMELHLSRKIAEKRVFPAIDY 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            +SGTRKE+LL  + +LQK+++LR+I+  M+  DA+EF+++KL  TK N +FF  M +
Sbjct: 361 NRSGTRKEELLTTQDELQKIWILRKIIHPMSEIDAMEFMMNKLSMTKTNDEFFDMMKR 418


>gi|294649380|ref|ZP_06726811.1| transcription termination factor Rho [Acinetobacter haemolyticus
           ATCC 19194]
 gi|292824750|gb|EFF83522.1| transcription termination factor Rho [Acinetobacter haemolyticus
           ATCC 19194]
          Length = 422

 Score =  570 bits (1469), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 272/419 (64%), Positives = 350/419 (83%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK K   +L+  AE + +E     RKQ+++F+ILK  +    EI G+GV+E+L D
Sbjct: 1   MNLTELKKKPIGELIKIAEFMGLEGMARNRKQDIIFAILKRHAMNGEEIFGDGVLEILSD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS   +YLAGPDDIYVSPSQI+ F+L+TGDT+ G+IR P+EGERYFALLKVN IN
Sbjct: 61  GFGFLRSAAGSYLAGPDDIYVSPSQIRRFNLRTGDTITGTIRPPKEGERYFALLKVNQIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           +D PE  RNKI F+NLTPL+P ++  MEL N   +D+++RV+DL+APIGKGQRS+IVAPP
Sbjct: 121 YDTPENSRNKILFENLTPLFPTEQLVMELGNGTTEDLTARVVDLVAPIGKGQRSIIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA SI +N+PE +LIVLLIDERPEEVT+M+R+V+GEVI+STFDE+ ARHV
Sbjct: 181 KAGKTMLLQNIAQSIVRNNPEVFLIVLLIDERPEEVTEMERTVRGEVIASTFDEAPARHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDA+AL+RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVIPSSGKVLTGGVDAHALERPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TAL++TGS+MD+VI+EEFKGTGN EI L+R+IA+KR+FPAM+I
Sbjct: 301 FGAARNIEEGGSLTIISTALIETGSKMDDVIYEEFKGTGNQEITLDRRIAEKRVFPAMNI 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQ 422
            KSGTR+E+ L++  +L+KV++LR+++  M+   A+EFL+D++K+TK N DFF  M ++
Sbjct: 361 KKSGTRREERLMDEDNLRKVWILRKLLHPMDELAAMEFLLDRMKETKTNDDFFDQMKRK 419


>gi|85711915|ref|ZP_01042970.1| transcription termination factor Rho [Idiomarina baltica OS145]
 gi|85694312|gb|EAQ32255.1| transcription termination factor Rho [Idiomarina baltica OS145]
          Length = 422

 Score =  570 bits (1469), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 271/419 (64%), Positives = 345/419 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELKNK   +L+  A+S+ +EN   +RKQ+++F+ILK  +    +I G GV+E+LQD
Sbjct: 1   MNLTELKNKPVNELVELADSMGLENMARLRKQDIIFAILKAHAKSGEDIYGGGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P++ ERYFALLK+  +N
Sbjct: 61  GFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTIGGKIRPPKDSERYFALLKIREVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           FD PE  RNKI F+NLTPL+ ++RF++E  N   +DI++RV+DL APIGKGQR LIVAPP
Sbjct: 121 FDKPENSRNKILFENLTPLHANERFHLERGNGSTEDITARVLDLSAPIGKGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA S+  NHPE  LIVLLIDERPEEVT+M R V+GEV++STFDE A RHV
Sbjct: 181 KAGKTMLLQNIATSLAANHPEAELIVLLIDERPEEVTEMHRLVKGEVVASTFDEPANRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANAL +PKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVIPSSGKVLTGGVDANALHKPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TAL+DTGS+MDEVI+EEFKGTGN E+ L RK+A++R+FPA+D 
Sbjct: 301 FGAARNVEEGGSLTIIATALIDTGSKMDEVIYEEFKGTGNMELHLNRKLAERRVFPAIDF 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQ 422
            +SGTR+E+LL  + +LQK+++LR+I++ M   +A+EFLID+L+ TK N +FF SM +Q
Sbjct: 361 NRSGTRREELLTSQDELQKMWILRKIMNPMGEVEAMEFLIDRLQMTKTNDEFFESMKRQ 419


>gi|330831667|ref|YP_004394619.1| transcription termination factor Rho [Aeromonas veronii B565]
 gi|328806803|gb|AEB52002.1| transcription termination factor Rho [Aeromonas veronii B565]
          Length = 411

 Score =  570 bits (1468), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 272/408 (66%), Positives = 335/408 (82%)

Query: 15  TKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQDGFGFLRSPDAN 74
           ++L+   ES+ +EN     K++++F+ILK  +    +I G+GV+E+L DGFGFLRS D +
Sbjct: 2   SELVKLGESMGLENLARAHKKDIIFAILKAHAKGGEDIFGDGVLEILTDGFGFLRSADGS 61

Query: 75  YLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAINFDVPERVRNKI 134
           YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P+EGERYFALLKVN +N+D PE  RNKI
Sbjct: 62  YLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNEVNYDRPENSRNKI 121

Query: 135 HFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPPRTGKTILLQNI 194
            F+NLTPL+ ++R  ME  N   +DI++RV+DL +PIGKGQR LIVAPP+ GKT+LLQNI
Sbjct: 122 LFENLTPLHANERLRMERGNGSTEDITARVLDLASPIGKGQRGLIVAPPKAGKTMLLQNI 181

Query: 195 AHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHVQVAEMVIAKAK 254
           A SI  NHP+C LIVLLIDERPEEVT+MQR V+GEVI+STFDE A+RHVQVAEMVI KAK
Sbjct: 182 AQSIAYNHPDCELIVLLIDERPEEVTEMQRMVKGEVIASTFDEPASRHVQVAEMVIEKAK 241

Query: 255 CLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRFFGAARNIKEGG 314
            LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANAL RPKRFFGAARN++EGG
Sbjct: 242 RLVEHKKDVVILLDSITRLARAYNTVIPSSGKVLTGGVDANALHRPKRFFGAARNVEEGG 301

Query: 315 SLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDIIKSGTRKEDLL 374
           SLTII TAL+DTGS+MDEVI+EEFKGTGN E+ L RKIA+KR++PA+DI +SGTRKE+LL
Sbjct: 302 SLTIIATALIDTGSKMDEVIYEEFKGTGNMELHLSRKIAEKRVYPAIDITRSGTRKEELL 361

Query: 375 VERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQ 422
               +LQK+++LR+IV  M   D IEFLIDKL  TK N +FF +M +Q
Sbjct: 362 TSGDELQKMWILRKIVHPMGEIDGIEFLIDKLAMTKTNDEFFDAMRRQ 409


>gi|262374321|ref|ZP_06067597.1| transcription termination factor Rho [Acinetobacter junii SH205]
 gi|262310879|gb|EEY91967.1| transcription termination factor Rho [Acinetobacter junii SH205]
          Length = 422

 Score =  570 bits (1468), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 271/419 (64%), Positives = 350/419 (83%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK K   +L+  AE + +E     RKQ+++F+ILK  +    EI G+GV+E+L D
Sbjct: 1   MNLTELKKKPIGELIKIAEFMGLEGMARNRKQDIIFAILKRHAMNGEEIFGDGVLEILSD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS   +YLAGPDDIYVSPSQI+ F+L+TGDT+ G+IR P+EGERYFALLKVN IN
Sbjct: 61  GFGFLRSAAGSYLAGPDDIYVSPSQIRRFNLRTGDTITGTIRPPKEGERYFALLKVNQIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           +D PE  RNKI F+NLTPL+P ++  MEL N   +D+++RV+DL+APIGKGQRS+IVAPP
Sbjct: 121 YDTPENSRNKILFENLTPLFPTEQLVMELGNGTTEDLTARVVDLVAPIGKGQRSIIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA SI +N+PE +LIVLLIDERPEEVT+M+R+V+GEV++STFDE+ ARHV
Sbjct: 181 KAGKTMLLQNIAQSIVRNNPEVFLIVLLIDERPEEVTEMERTVRGEVVASTFDEAPARHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDA+AL+RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVIPSSGKVLTGGVDAHALERPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TAL++TGS+MD+VI+EEFKGTGN EI L+R+IA+KR+FPAM+I
Sbjct: 301 FGAARNIEEGGSLTIISTALIETGSKMDDVIYEEFKGTGNQEITLDRRIAEKRVFPAMNI 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQ 422
            KSGTR+E+ L+  ++L+KV++LR+++  M+   A+EFL+D++K+TK N DFF  M ++
Sbjct: 361 KKSGTRREERLMGEENLRKVWILRKLLHPMDELAAMEFLLDRMKETKTNDDFFDQMKRK 419


>gi|255320838|ref|ZP_05362012.1| transcription termination factor Rho [Acinetobacter radioresistens
           SK82]
 gi|262380269|ref|ZP_06073424.1| transcription termination factor Rho [Acinetobacter radioresistens
           SH164]
 gi|255302007|gb|EET81250.1| transcription termination factor Rho [Acinetobacter radioresistens
           SK82]
 gi|262298463|gb|EEY86377.1| transcription termination factor Rho [Acinetobacter radioresistens
           SH164]
          Length = 420

 Score =  570 bits (1468), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 271/419 (64%), Positives = 350/419 (83%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK K   +L+  AE + +E     RKQ+++F+ILK  +    EI G+GV+E+L D
Sbjct: 1   MNLTELKKKPIGELIKIAEFMGLEGMARNRKQDIIFAILKRHAMNGEEIFGDGVLEILSD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS   +YLAGPDDIYVSPSQI+ F+L+TGDT+ G+IR P+EGERYFALLKVN IN
Sbjct: 61  GFGFLRSAAGSYLAGPDDIYVSPSQIRRFNLRTGDTITGTIRPPKEGERYFALLKVNQIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           +D PE  RNKI F+NLTPL+P ++  MEL N   +D+++RV+DL+APIGKGQRS+IVAPP
Sbjct: 121 YDTPENSRNKILFENLTPLFPTEQLVMELGNGTTEDLTARVVDLVAPIGKGQRSIIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA SI +N+PE +LIVLLIDERPEEVT+M+R+V+GEV++STFDES ARHV
Sbjct: 181 KAGKTMLLQNIAQSIVRNNPEVFLIVLLIDERPEEVTEMERTVRGEVVASTFDESPARHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGG+DA+AL+RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVIPSSGKVLTGGLDAHALERPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TAL++TGS+MD+VI+EEFKGTGN EI L+R+IA+KR+FPAM+I
Sbjct: 301 FGAARNIEEGGSLTIISTALIETGSKMDDVIYEEFKGTGNQEITLDRRIAEKRVFPAMNI 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQ 422
            KSGTR+E+ L+  ++L+KV++LR+++  M+   A+EFL+D++K+TK N DFF  M ++
Sbjct: 361 KKSGTRREERLMSEENLRKVWILRKLLHPMDELAAMEFLLDRMKETKTNDDFFDQMKRK 419


>gi|149908491|ref|ZP_01897153.1| transcription termination factor Rho [Moritella sp. PE36]
 gi|149808325|gb|EDM68262.1| transcription termination factor Rho [Moritella sp. PE36]
          Length = 420

 Score =  570 bits (1468), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 271/419 (64%), Positives = 343/419 (81%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELKN   ++L+   ES+ +EN   +RKQ+++FSILK  +    +I G+GV+E+LQD
Sbjct: 1   MNLTELKNTPVSELVKLGESMGLENLARLRKQDIIFSILKAHAKSGEDIFGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGDTV G IR P++GERYFALLK++ +N
Sbjct: 61  GFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTVGGKIRPPKDGERYFALLKIDQVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           +D PE  RNKI F+NLTP++P +R  +E  N   +DI++R++DL APIGKGQR LIVAPP
Sbjct: 121 YDRPENSRNKILFENLTPIHPIERLRLERGNGSTEDITARILDLSAPIGKGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA SI  NHP+  L+VLLIDERPEEVT+M+R V+GEVI+STFDE A+RHV
Sbjct: 181 KAGKTMLLQNIASSIALNHPDAILMVLLIDERPEEVTEMRRLVRGEVIASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEM+I KAK LVE+  DV+ILLDSITRL RAYN + PSSGKIL+GGVDANAL RPKRF
Sbjct: 241 QVAEMMIEKAKRLVEHKKDVIILLDSITRLARAYNTITPSSGKILSGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAAR ++EGGSLTII TAL+DTGS+MDEVI+EEFKGTGN E+ L RKIA++RI+PA+D 
Sbjct: 301 FGAARKVEEGGSLTIIATALIDTGSKMDEVIYEEFKGTGNQELHLNRKIAERRIYPAIDF 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQ 422
            +SGTR+E+LL ++ +LQK+++LR+I+  M   DA+EFLIDKL  TK N  FF +M KQ
Sbjct: 361 TRSGTRREELLADKNELQKMWILRKIIHPMGEIDAMEFLIDKLAMTKTNDQFFEAMKKQ 419


>gi|299771521|ref|YP_003733547.1| transcription termination factor Rho [Acinetobacter sp. DR1]
 gi|298701609|gb|ADI92174.1| transcription termination factor Rho [Acinetobacter sp. DR1]
          Length = 422

 Score =  570 bits (1468), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 272/419 (64%), Positives = 350/419 (83%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK K   +L+  AE + +E     RKQ+++F+ILK  +    EI G+GV+E+L D
Sbjct: 1   MNLTELKKKPIGELIKIAEFMGLEGMARNRKQDIIFAILKRHAMNGEEIFGDGVLEILSD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS   +YLAGPDDIYVSPSQI+ F+L+TGDT+ G+IR P+EGERYFALLKVN IN
Sbjct: 61  GFGFLRSAAGSYLAGPDDIYVSPSQIRRFNLRTGDTITGTIRPPKEGERYFALLKVNQIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           +D PE  RNKI F+NLTPL+P ++  MEL N   +D+++RV+DL+APIGKGQRS+IVAPP
Sbjct: 121 YDTPENSRNKILFENLTPLFPTEQLVMELGNGTTEDLTARVVDLVAPIGKGQRSIIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA SI +N+PE +LIVLLIDERPEEVT+M+R+V+GEVI+STFDE+ ARHV
Sbjct: 181 KAGKTMLLQNIAQSIVRNNPEVFLIVLLIDERPEEVTEMERTVRGEVIASTFDEAPARHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDA+AL+RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVIPSSGKVLTGGVDAHALERPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TAL++TGS+MD+VI+EEFKGTGN EI L+R+IA+KR+FPAM+I
Sbjct: 301 FGAARNIEEGGSLTIISTALIETGSKMDDVIYEEFKGTGNQEITLDRRIAEKRVFPAMNI 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQ 422
            KSGTR+E+ L++  +L+KV++LR+++  M+   A+EFL+D++K+TK N DFF  M ++
Sbjct: 361 KKSGTRREERLMDDDNLRKVWILRKLLHPMDELAAMEFLLDRMKETKTNDDFFDQMKRK 419


>gi|238899071|ref|YP_002924753.1| transcription termination factor Rho; polarity suppressor
           [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon
           pisum)]
 gi|229466831|gb|ACQ68605.1| transcription termination factor Rho; polarity suppressor
           [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon
           pisum)]
          Length = 419

 Score =  570 bits (1468), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 274/418 (65%), Positives = 341/418 (81%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELKN   ++L+   E++ +EN   +RKQ+++FSILK  +    +I G+GV+E+LQD
Sbjct: 1   MNLTELKNTPVSELITLGENMGLENLARIRKQDMIFSILKQHAKSGEDIFGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGDTV G IR P+EGERYFALLKVN +N
Sbjct: 61  GFGFLRSSDSSYLAGPDDIYVSPSQIRRFNLRTGDTVSGKIRPPKEGERYFALLKVNKVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           +D PE  RNKI F+NLTPL+ + R  M   N   +D+++RV+DL APIG GQR LIVAPP
Sbjct: 121 YDKPENARNKILFENLTPLHANSRLLMGRGNGSTEDLTARVLDLAAPIGCGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA SI  NHP+C L+VLLIDERPEEVT+MQR V+GEVI+STFDE AARHV
Sbjct: 181 KAGKTMLLQNIASSIAYNHPDCVLMVLLIDERPEEVTEMQRLVKGEVIASTFDEPAARHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEM+I KAK LVE+  DV+ILLDSITRL RAYN ++PSSGK+LTGGVDANAL RPKRF
Sbjct: 241 QVAEMMIEKAKRLVEHKKDVIILLDSITRLARAYNTVVPSSGKVLTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TALV+TGS+MDEVI+EEFKGTGN E+ L RKI++KR+FPA+D 
Sbjct: 301 FGAARNVEEGGSLTIIATALVETGSKMDEVIYEEFKGTGNMELHLSRKISEKRVFPAIDY 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            +SGTRKE+LL   ++LQK+++LR+I+  M   DA+EFLI+KL  TK N +FF  M +
Sbjct: 361 NRSGTRKEELLTTSEELQKMWILRKIIHPMGEIDAMEFLINKLAMTKTNDEFFDMMRR 418


>gi|90408659|ref|ZP_01216811.1| transcription termination factor Rho [Psychromonas sp. CNPT3]
 gi|90310235|gb|EAS38368.1| transcription termination factor Rho [Psychromonas sp. CNPT3]
          Length = 422

 Score =  570 bits (1468), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 269/419 (64%), Positives = 345/419 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELKN S  +L+   E+  +E+   +RKQ+++F+ILK  +    +I G GV+E+LQD
Sbjct: 1   MNLTELKNTSVAQLVQLGETKGLEHLARLRKQDIIFAILKAHAKSGEDIFGAGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D +YLAGPDDIY+SPSQI+ F+L+TGD+VEG IR P++GERYFALLK+N +N
Sbjct: 61  GFGFLRSSDCSYLAGPDDIYISPSQIRRFNLRTGDSVEGKIRPPKDGERYFALLKINKVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           F+ PE  RNKI F+NLTP++P +RF +E  N   +DI++R++DL++PIGKGQR LIVAPP
Sbjct: 121 FNKPEYSRNKILFENLTPIHPTERFRLESGNGSTEDITARILDLVSPIGKGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA SI  N+P+  LIVLLIDERPEEVT+M+R V+GEV++STFDE A+RHV
Sbjct: 181 KAGKTMLLQNIAQSISINYPDAVLIVLLIDERPEEVTEMRRLVRGEVVASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGG+DANAL RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVVPSSGKVLTGGIDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTI+ TAL+DTGS+MDEVI+EEFKGTGNSEI L RK+A+KRI+PA+DI
Sbjct: 301 FGAARNVEEGGSLTILATALIDTGSKMDEVIYEEFKGTGNSEIHLNRKLAEKRIYPAIDI 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQ 422
           I+SGTR+E+LL + ++LQ++++LR+IV  M    A EF+I KL  +K N DFF +M  Q
Sbjct: 361 IRSGTRREELLTKAEELQRMWILRQIVHPMGEIGATEFMISKLGLSKTNDDFFTAMKNQ 419


>gi|293610419|ref|ZP_06692720.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292827651|gb|EFF86015.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|325124575|gb|ADY84098.1| transcription termination factor Rho [Acinetobacter calcoaceticus
           PHEA-2]
          Length = 422

 Score =  570 bits (1468), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 272/419 (64%), Positives = 349/419 (83%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK K   +L+  AE + +E     RKQ+++F+ILK  +    EI G+GV+E+L D
Sbjct: 1   MNLTELKKKPIGELIKIAEFMGLEGMARNRKQDIIFAILKRHAMNGEEIFGDGVLEILSD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS   +YLAGPDDIYVSPSQI+ F+L+TGDT+ G+IR P+EGERYFALLKVN IN
Sbjct: 61  GFGFLRSAAGSYLAGPDDIYVSPSQIRRFNLRTGDTITGTIRPPKEGERYFALLKVNQIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           +D PE  RNKI F+NLTPL+P ++  MEL N   +D+++RV+DL+APIGKGQRS+IVAPP
Sbjct: 121 YDTPENSRNKILFENLTPLFPTEQLVMELGNGTTEDLTARVVDLVAPIGKGQRSIIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA SI +N+PE +LIVLLIDERPEEVT+M+R+V+GEVI+STFDE+ ARHV
Sbjct: 181 KAGKTMLLQNIAQSIVRNNPEVFLIVLLIDERPEEVTEMERTVRGEVIASTFDEAPARHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDA+AL+RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVIPSSGKVLTGGVDAHALERPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TAL++TGS+MD+VI+EEFKGTGN EI L+R+IA+KR+FPAM+I
Sbjct: 301 FGAARNIEEGGSLTIISTALIETGSKMDDVIYEEFKGTGNQEITLDRRIAEKRVFPAMNI 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQ 422
            KSGTR+E+ L++   L+KV++LR+++  M+   A+EFL+D++K+TK N DFF  M ++
Sbjct: 361 KKSGTRREERLMDEDKLRKVWILRKLLHPMDELAAMEFLLDRMKETKTNDDFFDQMKRK 419


>gi|226954294|ref|ZP_03824758.1| transcription termination factor Rho [Acinetobacter sp. ATCC 27244]
 gi|226834965|gb|EEH67348.1| transcription termination factor Rho [Acinetobacter sp. ATCC 27244]
          Length = 422

 Score =  569 bits (1467), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 271/419 (64%), Positives = 350/419 (83%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK K   +L+  AE + +E     RKQ+++F+ILK  +    EI G+GV+E+L D
Sbjct: 1   MNLTELKKKPIGELIKIAEFMGLEGMARNRKQDIIFAILKRHAMNGEEIFGDGVLEILSD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS   +YLAGPDDIYVSPSQI+ F+L+TGDT+ G+IR P+EGERYFALLKVN IN
Sbjct: 61  GFGFLRSAAGSYLAGPDDIYVSPSQIRRFNLRTGDTITGTIRPPKEGERYFALLKVNQIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           +D PE  RNKI F+NLTPL+P ++  MEL N   +D+++RV+DL+APIGKGQRS+IVAPP
Sbjct: 121 YDTPENSRNKILFENLTPLFPTEQLVMELGNGTTEDLTARVVDLVAPIGKGQRSIIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA SI +N+PE +LIVLLIDERPEEVT+M+R+V+GEV++STFDE+ ARHV
Sbjct: 181 KAGKTMLLQNIAQSIVRNNPEVFLIVLLIDERPEEVTEMERTVRGEVVASTFDEAPARHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDA+AL+RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVIPSSGKVLTGGVDAHALERPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TAL++TGS+MD+VI+EEFKGTGN EI L+R+IA+KR+FPAM+I
Sbjct: 301 FGAARNIEEGGSLTIISTALIETGSKMDDVIYEEFKGTGNQEITLDRRIAEKRVFPAMNI 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQ 422
            KSGTR+E+ L++  +L+KV++LR+++  M+   A+EFL+D++K+TK N DFF  M ++
Sbjct: 361 KKSGTRREERLMDEDNLRKVWILRKLLHPMDELAAMEFLLDRMKETKTNDDFFDQMKRK 419


>gi|189183421|ref|YP_001937206.1| transcription termination factor Rho [Orientia tsutsugamushi str.
           Ikeda]
 gi|189180192|dbj|BAG39972.1| transcription termination factor Rho [Orientia tsutsugamushi str.
           Ikeda]
          Length = 501

 Score =  569 bits (1467), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 281/417 (67%), Positives = 344/417 (82%), Gaps = 1/417 (0%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           + L ELK KSP  L  +AESL IENA+ + K EL+ +ILK++  R+  +I EGVIE+L  
Sbjct: 85  VHLNELKKKSPEALQCYAESLAIENASSLTKNELISAILKMVVERNGIVIEEGVIEILNG 144

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSP+ NYL+G  DIYVS SQIK   L+TGDTVEG IRAP+ GERYFALLKV  +N
Sbjct: 145 GFGFLRSPEVNYLSGAGDIYVSLSQIKRCELRTGDTVEGQIRAPKSGERYFALLKVLKVN 204

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
            +  ++   ++HFD+L  LYP+++ + E++  + K++S+RV++L++P+GKGQR+LIVAPP
Sbjct: 205 GEDIKKSIQRLHFDDLVALYPEEKISFEVD-LDYKNLSTRVMELVSPMGKGQRALIVAPP 263

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           RTGKTILLQNIAHSI  NHPE YLIVLLI ERPEEVTDM RSV+GEV+SSTFDE A RH 
Sbjct: 264 RTGKTILLQNIAHSIATNHPEIYLIVLLIGERPEEVTDMIRSVKGEVVSSTFDEPAVRHT 323

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           Q+AE+VI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVD+NALQ+PK F
Sbjct: 324 QLAEIVIEKAKRLVEHKRDVVILLDSITRLARAYNTVVPSSGKVLTGGVDSNALQKPKSF 383

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+ GGSLTII TALVDTGSRMDEVIFEEFKGTGNSEIVL+RKI+DKRI+PA+DI
Sbjct: 384 FGAARNIENGGSLTIIATALVDTGSRMDEVIFEEFKGTGNSEIVLDRKISDKRIYPAIDI 443

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
            KSGTRKE+LLV + +L K++MLRRI+  M + DA+EFL+DKLK TK N +FF  MN
Sbjct: 444 NKSGTRKEELLVGKSELSKMWMLRRIIHQMGAVDAMEFLLDKLKNTKSNSEFFDLMN 500


>gi|269467940|gb|EEZ79675.1| transcription termination factor [uncultured SUP05 cluster
           bacterium]
          Length = 420

 Score =  569 bits (1467), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 263/419 (62%), Positives = 352/419 (84%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           MKL ELK  +P +LL  A+SL +EN +  +KQ L+F+ILK  S  D E++G+GV++V+Q+
Sbjct: 1   MKLSELKRSTPAELLELAQSLGVENISRAKKQTLIFAILKAKSANDEEVLGDGVLDVMQE 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           G+GFLRS D +Y++GPDD+YVSP+QI+ F+L TGD V G IRAP++GE+YFAL++V+ +N
Sbjct: 61  GYGFLRSSDDSYVSGPDDMYVSPNQIRRFNLSTGDLVAGKIRAPKKGEKYFALIQVSEVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
            + PE +RN+I F +LTP++PD+R  +E+ N   +DI++RVIDL+AP GKGQR L+VAPP
Sbjct: 121 GENPENIRNRIPFASLTPIHPDERLGLEIGNGGTEDITARVIDLVAPFGKGQRGLLVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+++QNIA SI +NHPEC LIVLLIDERPEEVT+M+R+V+GEVI+STFDESA RHV
Sbjct: 181 KAGKTMIMQNIASSISRNHPECELIVLLIDERPEEVTEMERTVRGEVIASTFDESAKRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK   E G DV+ILLDSITRL RAYN + PSSGK+LTGGVDANALQRPKRF
Sbjct: 241 QVAEMVIQKAKRRAEQGKDVIILLDSITRLARAYNTVAPSSGKVLTGGVDANALQRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+ GGS+TII TAL+DTGS+MDEVI++EFKGTGN E+ LER++++KRIFPA++I
Sbjct: 301 FGAARNIENGGSITIIATALIDTGSKMDEVIYQEFKGTGNMELHLERRLSEKRIFPAINI 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQ 422
             SGTR+E+L+ + ++LQK+++LR+I+  M++ +A EFLID+LK TK N +FF SM+++
Sbjct: 361 NASGTRREELITDEKELQKMWILRKILHPMDTVEAAEFLIDRLKLTKTNDEFFSSMSQK 419


>gi|254496684|ref|ZP_05109547.1| transcription termination factor Rho [Legionella drancourtii
           LLAP12]
 gi|254354112|gb|EET12784.1| transcription termination factor Rho [Legionella drancourtii
           LLAP12]
          Length = 420

 Score =  569 bits (1467), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 271/419 (64%), Positives = 342/419 (81%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK      L   A+ + +EN + MRKQE++F+ILK  + +  +I G+GV+EVL D
Sbjct: 1   MNLSELKQLPIADLFNIAQEIGVENPSRMRKQEIIFAILKAHALKGADIHGDGVLEVLTD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D +YLAGPDDIYVSPSQI+ F L++GDT+ G IR P++ ERYFALLKV+ IN
Sbjct: 61  GFGFLRSADGSYLAGPDDIYVSPSQIRRFGLRSGDTISGKIRPPKDSERYFALLKVDEIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           +D P+  + KI F+NLTPL+  +R  ME  N   +D+++RV+DL AP G+GQR LIV+PP
Sbjct: 121 YDSPDSAKRKILFENLTPLFASERLVMEQGNGSTEDLTARVVDLCAPFGRGQRGLIVSPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT++LQNIA SI+KN+PECYLIVLLIDERPEEVT+MQRSV+GEV++STFDE A RHV
Sbjct: 181 KAGKTLMLQNIARSIEKNYPECYLIVLLIDERPEEVTEMQRSVKGEVVASTFDEPANRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRPKR 
Sbjct: 241 QVAEMVIEKAKRLVEHKRDVVILLDSITRLARAYNTVIPSSGKVLTGGVDANALQRPKRL 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           +GAARNI+EGGSLTII TALVDTGS+MDEVI+EEFKGTGN EI L R IA++R+FPA++I
Sbjct: 301 YGAARNIEEGGSLTIIATALVDTGSKMDEVIYEEFKGTGNMEIHLSRNIAERRVFPAINI 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQ 422
            +SGTR+EDLL+  +DLQ+ ++LR+I+ SM+  DAIEFLI+++K  K N +FF +M +Q
Sbjct: 361 NRSGTRREDLLLSPEDLQRTWILRKILQSMDECDAIEFLIERMKNHKTNAEFFDAMKRQ 419


>gi|331006630|ref|ZP_08329915.1| Transcription termination factor Rho [gamma proteobacterium
           IMCC1989]
 gi|330419569|gb|EGG93950.1| Transcription termination factor Rho [gamma proteobacterium
           IMCC1989]
          Length = 419

 Score =  569 bits (1467), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 265/419 (63%), Positives = 350/419 (83%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L +LK K   +L+  A+ + ++N    RKQ+++F+ILK  +    +I G+GV+E+LQD
Sbjct: 1   MNLTDLKTKPIEELIKLAKEMGLDNVARSRKQDIIFNILKRHAKGGEDIYGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P+EGERYFALLKVN IN
Sbjct: 61  GFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNQIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           FD PE  +NKI F+NLTPL+PD R  +E  N   +D++ R+IDL++PIGKGQR LIVAPP
Sbjct: 121 FDKPENSKNKILFENLTPLFPDDRLTLEAGNGSTEDLTGRIIDLVSPIGKGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKTI++QNIA +I +N+PEC+LIVLLIDERPEEVT+MQRSV+GEV++STFDE  +RHV
Sbjct: 181 KAGKTIMMQNIAQAITRNNPECHLIVLLIDERPEEVTEMQRSVRGEVVASTFDEPPSRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI +AK LVE+  DV+ILLDSITRL RAYN ++PSSGK+LTGGVDA+AL+RPKRF
Sbjct: 241 QVAEMVIERAKRLVEHKKDVIILLDSITRLARAYNTVIPSSGKVLTGGVDAHALERPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSL+I+ TAL+DTGS+MDEVI+EEFKGTGN E+ L+RK+A+KRI+PA+++
Sbjct: 301 FGAARNIEEGGSLSIVATALIDTGSKMDEVIYEEFKGTGNLELHLDRKVAEKRIYPAINV 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQ 422
            +SGTR+E+LL++  +LQ+V++LR++++ M   +A EFL+DKLK  K N +FF SM ++
Sbjct: 361 RRSGTRREELLIKEDELQRVWILRKLLNDMEDVNATEFLVDKLKDFKSNDEFFLSMKRK 419


>gi|15617182|ref|NP_240395.1| transcription termination factor Rho [Buchnera aphidicola str. APS
           (Acyrthosiphon pisum)]
 gi|219681932|ref|YP_002468318.1| transcription termination factor Rho [Buchnera aphidicola str. 5A
           (Acyrthosiphon pisum)]
 gi|219682487|ref|YP_002468871.1| transcription termination factor Rho [Buchnera aphidicola str. Tuc7
           (Acyrthosiphon pisum)]
 gi|257471644|ref|ZP_05635643.1| transcription termination factor Rho [Buchnera aphidicola str. LSR1
           (Acyrthosiphon pisum)]
 gi|11134337|sp|P57652|RHO_BUCAI RecName: Full=Transcription termination factor Rho; AltName:
           Full=ATP-dependent helicase Rho
 gi|25299642|pir||A84999 transcription termination factor rho [imported] - Buchnera sp.
           (strain APS)
 gi|10039247|dbj|BAB13281.1| transcription termination factor rho [Buchnera aphidicola str. APS
           (Acyrthosiphon pisum)]
 gi|219622220|gb|ACL30376.1| transcription termination factor Rho [Buchnera aphidicola str. Tuc7
           (Acyrthosiphon pisum)]
 gi|219624775|gb|ACL30930.1| transcription termination factor Rho [Buchnera aphidicola str. 5A
           (Acyrthosiphon pisum)]
 gi|311086316|gb|ADP66398.1| transcription termination factor Rho [Buchnera aphidicola str. LL01
           (Acyrthosiphon pisum)]
 gi|311086890|gb|ADP66971.1| transcription termination factor Rho [Buchnera aphidicola str.
           TLW03 (Acyrthosiphon pisum)]
 gi|311087480|gb|ADP67560.1| transcription termination factor Rho [Buchnera aphidicola str. JF99
           (Acyrthosiphon pisum)]
          Length = 419

 Score =  569 bits (1467), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 271/418 (64%), Positives = 341/418 (81%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L  LKN   ++L+   E + +EN   MRKQ+++F+ILK  +    +I G+GV+E+LQD
Sbjct: 1   MNLTALKNMPVSELITLGEKMGLENLARMRKQDIIFAILKQHAKSGEDIFGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P+EGERYFALLKVN +N
Sbjct: 61  GFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTIAGKIRPPKEGERYFALLKVNEVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           +D PE  R+KI F+NLTPL+ + R  ME  N   +D+++RV+DL +PIG+GQR LIVAPP
Sbjct: 121 YDKPENARSKILFENLTPLHANSRLRMERGNGSTEDLTARVLDLASPIGRGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKTILLQNIA SI  NHP+C L+VLLIDERPEEVT+MQR V+GEV++STFDE A+RHV
Sbjct: 181 KAGKTILLQNIAQSIAYNHPDCVLMVLLIDERPEEVTEMQRLVKGEVVASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DV+ILLDSITRL RAYN ++P+SGK+LTGGVDANAL RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVIILLDSITRLARAYNTVVPASGKVLTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TALVDTGS+MDEVI+EEFKGTGN E+ L RKIA+KR+FPA+D 
Sbjct: 301 FGAARNVEEGGSLTIIATALVDTGSKMDEVIYEEFKGTGNMELPLSRKIAEKRVFPAIDY 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            +SGTRKE+LL    +LQK+++LR+I+  M+  DA+EFL++KL  TK N +FF  M +
Sbjct: 361 NRSGTRKEELLTLPDELQKMWILRKIIHPMSEIDAMEFLLNKLAMTKTNDEFFDMMKR 418


>gi|50086051|ref|YP_047561.1| transcription termination factor Rho [Acinetobacter sp. ADP1]
 gi|49532027|emb|CAG69739.1| transcription termination factor [Acinetobacter sp. ADP1]
          Length = 422

 Score =  569 bits (1467), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 272/419 (64%), Positives = 350/419 (83%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK K   +L+  AE + +E     RKQ+++F+ILK  +    EI G+GV+E+L D
Sbjct: 1   MNLTELKKKPIGELIKIAEFMGLEGMARNRKQDIIFAILKRHAMNGEEIFGDGVLEILSD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS   +YLAGPDDIYVSPSQI+ F+L+TGDT+ G+IR P+EGERYFALLKVN IN
Sbjct: 61  GFGFLRSAAGSYLAGPDDIYVSPSQIRRFNLRTGDTITGTIRPPKEGERYFALLKVNQIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           +D PE  RNKI F+NLTPL+P ++  MEL N   +D+++RV+DLIAPIGKGQRS+IVAPP
Sbjct: 121 YDTPENSRNKILFENLTPLFPTEQLVMELGNGTTEDLTTRVVDLIAPIGKGQRSIIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQ+IA SI +N+PE +LIVLLIDERPEEVT+M+R+V+GEV++STFDES ARHV
Sbjct: 181 KAGKTMLLQSIAQSIVRNNPEVFLIVLLIDERPEEVTEMERTVRGEVVASTFDESPARHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDA+AL+RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVIPSSGKVLTGGVDAHALERPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TAL++TGS+MD+VI+EEFKGTGN EI L+R+IA+KR+FPAM+I
Sbjct: 301 FGAARNIEEGGSLTIISTALIETGSKMDDVIYEEFKGTGNQEITLDRRIAEKRVFPAMNI 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQ 422
            KSGTR+E+ L++  +L+KV++LR+++  M+   A+EFL+D++K+TK N DFF  M ++
Sbjct: 361 KKSGTRREERLMDEDNLRKVWILRKLLHPMDELAAMEFLLDRMKETKTNDDFFDQMKRK 419


>gi|169634328|ref|YP_001708064.1| transcription termination factor Rho [Acinetobacter baumannii SDF]
 gi|169797144|ref|YP_001714937.1| transcription termination factor Rho [Acinetobacter baumannii AYE]
 gi|184156929|ref|YP_001845268.1| transcription termination factor Rho [Acinetobacter baumannii
           ACICU]
 gi|213156065|ref|YP_002318110.1| transcription termination factor Rho [Acinetobacter baumannii
           AB0057]
 gi|215484607|ref|YP_002326842.1| transcription termination factor Rho [Acinetobacter baumannii
           AB307-0294]
 gi|239500686|ref|ZP_04659996.1| transcription termination factor Rho [Acinetobacter baumannii
           AB900]
 gi|260551928|ref|ZP_05825790.1| transcription termination factor Rho [Acinetobacter sp. RUH2624]
 gi|260556046|ref|ZP_05828265.1| transcription termination factor Rho [Acinetobacter baumannii ATCC
           19606]
 gi|301344688|ref|ZP_07225429.1| transcription termination factor Rho [Acinetobacter baumannii
           AB056]
 gi|301510190|ref|ZP_07235427.1| transcription termination factor Rho [Acinetobacter baumannii
           AB058]
 gi|301595526|ref|ZP_07240534.1| transcription termination factor Rho [Acinetobacter baumannii
           AB059]
 gi|332856883|ref|ZP_08436292.1| transcription termination factor Rho [Acinetobacter baumannii
           6013150]
 gi|332867215|ref|ZP_08437480.1| transcription termination factor Rho [Acinetobacter baumannii
           6013113]
 gi|332873994|ref|ZP_08441929.1| transcription termination factor Rho [Acinetobacter baumannii
           6014059]
 gi|169150071|emb|CAM87965.1| transcription termination factor [Acinetobacter baumannii AYE]
 gi|169153120|emb|CAP02194.1| transcription termination factor [Acinetobacter baumannii]
 gi|183208523|gb|ACC55921.1| Transcription termination factor [Acinetobacter baumannii ACICU]
 gi|213055225|gb|ACJ40127.1| transcription termination factor Rho [Acinetobacter baumannii
           AB0057]
 gi|213988657|gb|ACJ58956.1| transcription termination factor Rho [Acinetobacter baumannii
           AB307-0294]
 gi|260405331|gb|EEW98826.1| transcription termination factor Rho [Acinetobacter sp. RUH2624]
 gi|260410101|gb|EEX03400.1| transcription termination factor Rho [Acinetobacter baumannii ATCC
           19606]
 gi|322506825|gb|ADX02279.1| rho [Acinetobacter baumannii 1656-2]
 gi|323516694|gb|ADX91075.1| transcription termination factor Rho [Acinetobacter baumannii
           TCDC-AB0715]
 gi|332726937|gb|EGJ58442.1| transcription termination factor Rho [Acinetobacter baumannii
           6013150]
 gi|332734154|gb|EGJ65286.1| transcription termination factor Rho [Acinetobacter baumannii
           6013113]
 gi|332737735|gb|EGJ68627.1| transcription termination factor Rho [Acinetobacter baumannii
           6014059]
          Length = 422

 Score =  569 bits (1466), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 271/419 (64%), Positives = 349/419 (83%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK K   +L+  AE + +E     RKQ+++F+ILK  +    EI G+GV+E+L D
Sbjct: 1   MNLTELKKKPIGELIKIAEFMGLEGMARNRKQDIIFAILKRHAMNGEEIFGDGVLEILSD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS   +YLAGPDDIYVSPSQI+ F+L+TGDT+ G+IR P+EGERYFALLKVN IN
Sbjct: 61  GFGFLRSAAGSYLAGPDDIYVSPSQIRRFNLRTGDTITGTIRPPKEGERYFALLKVNQIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           +D PE  RNKI F+NLTPL+P ++  MEL N   +D+++RV+DL+APIGKGQRS+IVAPP
Sbjct: 121 YDTPENSRNKILFENLTPLFPTEQLVMELGNGTTEDLTARVVDLVAPIGKGQRSIIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA SI +N+PE +LIVLLIDERPEEVT+M+R+V+GEV++STFDE+ ARHV
Sbjct: 181 KAGKTMLLQNIAQSIVRNNPEVFLIVLLIDERPEEVTEMERTVRGEVVASTFDEAPARHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDA+AL+RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVIPSSGKVLTGGVDAHALERPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TAL++TGS+MD+VI+EEFKGTGN EI L+R+IA+KR+FPAM+I
Sbjct: 301 FGAARNIEEGGSLTIISTALIETGSKMDDVIYEEFKGTGNQEITLDRRIAEKRVFPAMNI 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQ 422
            KSGTR+E+ L++   L+KV++LR+++  M+   A+EFL+D++K+TK N DFF  M ++
Sbjct: 361 KKSGTRREERLMDEDKLRKVWILRKLLHPMDELAAMEFLLDRMKETKTNDDFFDQMKRK 419


>gi|255020937|ref|ZP_05292993.1| Transcription termination factor Rho [Acidithiobacillus caldus ATCC
           51756]
 gi|254969728|gb|EET27234.1| Transcription termination factor Rho [Acidithiobacillus caldus ATCC
           51756]
          Length = 456

 Score =  568 bits (1465), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 265/418 (63%), Positives = 348/418 (83%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK KS  +L    + + ++  + ++KQE++F+ILK  +     I G+GV+E+LQD
Sbjct: 39  MNLSELKRKSAAELAVICQDMGLDGTSRLKKQEIIFNILKAHARNGDAIYGDGVLEILQD 98

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLR+   +Y+AGPDDIYVSPSQ++ F L+TGDTV G IR P+EGERYFALLKV +IN
Sbjct: 99  GFGFLRAASGSYMAGPDDIYVSPSQVRRFHLQTGDTVSGQIRPPKEGERYFALLKVESIN 158

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           F+ P+  RNK++FD+LTPL+P++R  +E +N    +++ R+IDL++PIGKGQR LIVAPP
Sbjct: 159 FEGPDATRNKVNFDDLTPLFPEERLRLESDNIPYGEVAPRIIDLVSPIGKGQRGLIVAPP 218

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           +TGKT+LLQ +AH+I  NHPECYLIVLLIDERPEEVT+MQRSV+GEV+SSTFDE A RHV
Sbjct: 219 KTGKTVLLQQVAHAITANHPECYLIVLLIDERPEEVTEMQRSVKGEVVSSTFDEPATRHV 278

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAE+V+ KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQ+PKRF
Sbjct: 279 QVAEIVLEKAKRLVEHKHDVVILLDSITRLARAYNTVVPSSGKVLTGGVDANALQKPKRF 338

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TALV+TGS+MDEVIFEEFKGTGN E+ L+R++A+KR +PA++I
Sbjct: 339 FGAARNIEEGGSLTIIATALVETGSKMDEVIFEEFKGTGNMEVHLDRRLAEKRTYPAINI 398

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            KSGTR+E+LLV    L K+++LR++++ M+  +++EFL+DK+K TK+N +F+ SMN+
Sbjct: 399 NKSGTRREELLVPADILSKMWILRKLLAPMDPLESMEFLLDKVKATKNNAEFYDSMNR 456


>gi|302342171|ref|YP_003806700.1| transcription termination factor Rho [Desulfarculus baarsii DSM
           2075]
 gi|301638784|gb|ADK84106.1| transcription termination factor Rho [Desulfarculus baarsii DSM
           2075]
          Length = 468

 Score =  568 bits (1465), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 277/418 (66%), Positives = 341/418 (81%), Gaps = 1/418 (0%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M + ELK K   +L A A +  IE A  MRKQEL+F++L   + R+  I GEGV+E+L D
Sbjct: 52  MNIIELKVKPIAELTAMARTFNIEGAAGMRKQELIFALLTAQAERNGAIYGEGVLEILPD 111

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLR+PD NYL GPDDIYVSPSQI+ F+L+TGDT+ G IR P+EGERYFALLKV  IN
Sbjct: 112 GFGFLRAPDYNYLPGPDDIYVSPSQIRRFNLRTGDTISGQIRPPKEGERYFALLKVEKIN 171

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
            + PE  R+KI FDNL PLYPD+R  +E+   + K+ S RV+DL+ PIGKGQR LIVAPP
Sbjct: 172 MEPPEVARDKILFDNLVPLYPDERIRLEVEA-QPKNFSIRVMDLMTPIGKGQRGLIVAPP 230

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           RTGKT+LLQNIA+++  NHPE  LIVLLIDERPEEVTDMQRSV+GEVISSTFDE A RHV
Sbjct: 231 RTGKTMLLQNIANALAANHPEVTLIVLLIDERPEEVTDMQRSVKGEVISSTFDEPAQRHV 290

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++P SGKIL+GGVD+NAL RPKRF
Sbjct: 291 QVAEMVIEKAKRLVEHKRDVVILLDSITRLARAYNTVVPPSGKILSGGVDSNALHRPKRF 350

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI++GGSLTII TAL++TGSRMDEVIFEEFKGTGN EI L+RK++DKR+FPA+DI
Sbjct: 351 FGAARNIEDGGSLTIIATALIETGSRMDEVIFEEFKGTGNMEIHLDRKLSDKRVFPAIDI 410

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            +SGTRKE+LL+   DL ++++LR+++  + + D++EFL++KL+ TK N +F  SM++
Sbjct: 411 NRSGTRKEELLLPESDLNRIWILRKLLGPLTAVDSMEFLLEKLQGTKSNTEFLDSMSR 468


>gi|114332430|ref|YP_748652.1| transcription termination factor Rho [Nitrosomonas eutropha C91]
 gi|114309444|gb|ABI60687.1| transcription termination factor Rho [Nitrosomonas eutropha C91]
          Length = 419

 Score =  568 bits (1465), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 269/418 (64%), Positives = 352/418 (84%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M+L +LK+   ++L+  A + +IE AN MRKQ+L+F++LK  + +   I GEG +E+LQD
Sbjct: 1   MRLSDLKSIHVSELVKMAIANDIEGANRMRKQDLVFALLKNQARKGESIFGEGTLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSPD +YLAGPDDIY+SPSQI+ F+L TGD+V+G IR P+EGERYFAL+K++ +N
Sbjct: 61  GFGFLRSPDTSYLAGPDDIYISPSQIRRFNLHTGDSVDGEIRPPKEGERYFALVKIDKVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
            + PE  + KI F+NLTPL+P +R  +E +N   ++I+ R+IDLIAPIGKGQR L+VA P
Sbjct: 121 NEPPENSKRKILFENLTPLFPTERLTLERDNKSEENITGRIIDLIAPIGKGQRGLLVASP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           ++GKT++LQ+IAHSI  NHP+  L+VLLIDERPEEVT+M RSV+GEVISSTFDESAARHV
Sbjct: 181 KSGKTVMLQHIAHSIAANHPDVVLMVLLIDERPEEVTEMVRSVRGEVISSTFDESAARHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVA+MVI KAK LVE+  DVVILLDSITRL RAYN+++P+SGK+LTGGVDANALQRPKRF
Sbjct: 241 QVADMVIEKAKRLVEHKKDVVILLDSITRLARAYNMIVPASGKVLTGGVDANALQRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TALVDTGSRMD+VI+EEFKGTGN EI L+R++A+KRI+PA+++
Sbjct: 301 FGAARNIEEGGSLTIIATALVDTGSRMDDVIYEEFKGTGNMEIHLDRRMAEKRIYPAINV 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            +SGTR+E+LL+  + LQK+++LR+++  M+  DA+ FL+DK+K TK+N DFF SM +
Sbjct: 361 NRSGTRREELLISSEILQKIWILRKLLYPMDEMDAMSFLLDKIKATKNNADFFDSMRR 418


>gi|71066544|ref|YP_265271.1| transcription termination factor Rho [Psychrobacter arcticus 273-4]
 gi|93007117|ref|YP_581554.1| transcription termination factor Rho [Psychrobacter cryohalolentis
           K5]
 gi|71039529|gb|AAZ19837.1| transcription termination factor Rho [Psychrobacter arcticus 273-4]
 gi|92394795|gb|ABE76070.1| transcription termination factor Rho [Psychrobacter cryohalolentis
           K5]
          Length = 435

 Score =  568 bits (1464), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 269/420 (64%), Positives = 346/420 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK KS  +LLA A+ + ++N    RKQ+++F+ILK  +     I G+GV+EVL D
Sbjct: 14  MNLTELKKKSIAELLAIAKEMGLDNMARSRKQDIIFAILKTHARNGEAIYGDGVLEVLPD 73

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS + +YLAGPDDIYVSPSQI+ FSLKTGD++ G+IR P++ ERYFALLKV  IN
Sbjct: 74  GFGFLRSSEGSYLAGPDDIYVSPSQIRRFSLKTGDSIAGTIRPPKDSERYFALLKVGEIN 133

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           FD P+R R+K+ F+NLTPL+P ++  +EL N   +D++ R+IDLIAPIGKGQRS+IVAPP
Sbjct: 134 FDTPDRSRHKLIFENLTPLFPTEQLKLELGNGTTEDLTGRIIDLIAPIGKGQRSIIVAPP 193

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQ+IA SI +N+PECYLIVLLIDERPEEVT+M+R+V+GEV++STFDE   RHV
Sbjct: 194 KAGKTMLLQSIAQSITRNNPECYLIVLLIDERPEEVTEMERTVRGEVVASTFDEPPQRHV 253

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGG+DANAL+RPKRF
Sbjct: 254 QVAEMVIEKAKRLVEHKQDVVILLDSITRLARAYNTVIPSSGKVLTGGLDANALERPKRF 313

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII +AL+DTGS+MD VIFEEFKGTGN EI LER +A+KR+FPA++I
Sbjct: 314 FGAARNIEEGGSLTIIASALIDTGSKMDSVIFEEFKGTGNQEITLERDLAEKRVFPAINI 373

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQN 423
            KSGTR+E+ L++   L+KV++LR+++  M+   A EFL+D+LK+ K N +FF  M +++
Sbjct: 374 KKSGTRREERLLDEDKLRKVWILRKLLQPMDGVQATEFLLDRLKEAKTNDEFFEQMKRKS 433


>gi|148284565|ref|YP_001248655.1| transcription termination factor Rho [Orientia tsutsugamushi str.
           Boryong]
 gi|146740004|emb|CAM80078.1| transcription termination factor [Orientia tsutsugamushi str.
           Boryong]
          Length = 501

 Score =  568 bits (1464), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 281/417 (67%), Positives = 344/417 (82%), Gaps = 1/417 (0%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           + L ELK KSP  L  +AESL IENA+ + K EL+ +ILK++  R+  +I EGVIE+L  
Sbjct: 85  VHLNELKKKSPEALQCYAESLAIENASSLTKNELISAILKMVVERNGTVIEEGVIEILNG 144

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSP+ NYL+G  DIYVS SQIK   L+TGDTVEG IRAP+ GERYFALLKV  +N
Sbjct: 145 GFGFLRSPEVNYLSGAGDIYVSLSQIKRCELRTGDTVEGQIRAPKSGERYFALLKVLKVN 204

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
            +  ++   ++HFD+L  LYP+++   E++  + K++S+RV++L++P+GKGQR+LIVAPP
Sbjct: 205 GEDIKKSIQRLHFDDLVALYPEEKIFFEVD-LDYKNLSTRVMELVSPMGKGQRALIVAPP 263

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           RTGKTILLQNIAHSI  NHPE YLIVLLI ERPEEVTDM RSV+GEV+SSTFDE A RH 
Sbjct: 264 RTGKTILLQNIAHSIATNHPEIYLIVLLIGERPEEVTDMIRSVKGEVVSSTFDEPAVRHT 323

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           Q+AE+VI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVD+NALQ+PK F
Sbjct: 324 QLAEIVIEKAKRLVEHKRDVVILLDSITRLARAYNTVVPSSGKVLTGGVDSNALQKPKSF 383

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+ GGSLTII TALVDTGSRMDEVIFEEFKGTGNSEIVL+RKI+DKRI+PA+DI
Sbjct: 384 FGAARNIENGGSLTIIATALVDTGSRMDEVIFEEFKGTGNSEIVLDRKISDKRIYPAIDI 443

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
            KSGTRKE+LLV + +L K++MLRRI++ M + DA+EFL+DKLK TK N +FF  MN
Sbjct: 444 NKSGTRKEELLVGKSELSKMWMLRRIINQMGAVDAMEFLLDKLKNTKSNSEFFDLMN 500


>gi|262374863|ref|ZP_06068097.1| transcription termination factor Rho [Acinetobacter lwoffii SH145]
 gi|262309876|gb|EEY91005.1| transcription termination factor Rho [Acinetobacter lwoffii SH145]
          Length = 422

 Score =  568 bits (1463), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 272/419 (64%), Positives = 348/419 (83%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK K   +L+  AE + +E     RKQ+++F+ILK  +    EI G+GV+E+L D
Sbjct: 1   MNLTELKKKPIGELIKIAEFMGLEGMARNRKQDIIFAILKRHAMNGEEIFGDGVLEILSD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS   +YLAGPDDIYVSPSQI+ F+L+TGDT+ G+IR P+EGERYFALLKVN IN
Sbjct: 61  GFGFLRSAAGSYLAGPDDIYVSPSQIRRFNLRTGDTITGTIRPPKEGERYFALLKVNQIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           +D PE  RNKI F+NLTPL+P ++  MEL N   +D+++RVIDL+APIGKGQRS+IVAPP
Sbjct: 121 YDTPENSRNKILFENLTPLFPTEQLVMELGNGTTEDLTTRVIDLVAPIGKGQRSIIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQ+IA SI +N+PE  LIVLLIDERPEEVT+M+R+V+GEV++STFDES ARHV
Sbjct: 181 KAGKTMLLQSIAQSIVRNNPEVILIVLLIDERPEEVTEMERTVRGEVVASTFDESPARHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDA+AL+RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVIPSSGKVLTGGVDAHALERPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TAL++TGS+MDEVI+EEFKGTGN EI L+R+IA+KR+FPAM+I
Sbjct: 301 FGAARNIEEGGSLTIISTALIETGSKMDEVIYEEFKGTGNQEITLDRRIAEKRVFPAMNI 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQ 422
            KSGTR+E+ L+   +L+KV++LR+++ + +   A+EFL+D++K+TK N DFF  M ++
Sbjct: 361 KKSGTRREERLMSEDNLRKVWILRKLLHTQDELAAMEFLLDRMKETKTNDDFFDQMKRK 419


>gi|226940611|ref|YP_002795685.1| transcription termination factor Rho [Laribacter hongkongensis
           HLHK9]
 gi|226715538|gb|ACO74676.1| Rho [Laribacter hongkongensis HLHK9]
          Length = 418

 Score =  568 bits (1463), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 267/418 (63%), Positives = 351/418 (83%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L +LK+   +KL+  A   +IE AN +RKQ+L+F++LK  + +   I G+G +EVL D
Sbjct: 1   MHLSDLKHLHVSKLVEMAAENDIEGANRLRKQDLIFALLKGQAKKGESIFGDGTLEVLPD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSPD +YLAGPDDIYVSPSQI+ F+L TGD++EG IR P+EGERYFAL+KV+ IN
Sbjct: 61  GFGFLRSPDTSYLAGPDDIYVSPSQIRRFNLHTGDSIEGEIRTPKEGERYFALVKVDRIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
            ++PE+ +NKI F+NLTPL+P +R  +E +    ++I+ R+ID+IAPIGKGQR L+VAPP
Sbjct: 121 SELPEKSKNKILFENLTPLHPTERLTLERDIRAEENITGRIIDMIAPIGKGQRGLLVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           ++GKT++LQNIAH+I  NHP+  LIVLLIDERPEEVT+M R+V+GEV++STFDE A RHV
Sbjct: 181 KSGKTVMLQNIAHAITANHPDVVLIVLLIDERPEEVTEMTRTVRGEVVASTFDEPATRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVVPSSGKVLTGGVDANALQRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII +AL+DTGSRMD+VI+EEFKGTGNSEI L+R++A+KRIFPA++I
Sbjct: 301 FGAARNIEEGGSLTIIASALIDTGSRMDDVIYEEFKGTGNSEIHLDRRMAEKRIFPAINI 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            +SGTR+E+LL+ ++ LQ++++LR+++  M+  +A++FL+DK+K TK N+ FF SM +
Sbjct: 361 NRSGTRREELLIPQEQLQRMWVLRKLLYPMDDLEAMDFLLDKIKSTKSNQQFFDSMRR 418


>gi|91776642|ref|YP_546398.1| transcription termination factor Rho [Methylobacillus flagellatus
           KT]
 gi|91710629|gb|ABE50557.1| transcription termination factor Rho [Methylobacillus flagellatus
           KT]
          Length = 419

 Score =  568 bits (1463), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 269/418 (64%), Positives = 353/418 (84%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L +LK+   T+L+  A + EIE A+ +RKQ+L+F+ILK  + +   I G+G +EVLQD
Sbjct: 1   MHLSDLKHLPVTELVEMAIANEIEGASRIRKQDLIFAILKNKAKKGDSIFGDGTLEVLQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSPD +YLAGPDDIYVSPSQI+ F+L TGDT++G IR P++GERYFAL+KV+++N
Sbjct: 61  GFGFLRSPDTSYLAGPDDIYVSPSQIRRFNLHTGDTIQGEIRTPKDGERYFALVKVDSVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
            + PE  ++KI F+NLTPL+P K   +E +    ++I+ RVID+IAPIGKGQR+L+VAPP
Sbjct: 121 GEAPENSKHKILFENLTPLFPTKPLVLERDIRSEENITGRVIDMIAPIGKGQRALLVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           ++GKT+++Q+IAH+I  NHP+  LIVL+IDERPEEVT+M RSV+GEV++STFDE A RHV
Sbjct: 181 KSGKTVMMQHIAHAITANHPDVVLIVLMIDERPEEVTEMTRSVKGEVVASTFDEPATRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMV+ KAK LVE+  DVVILLDSITRL RAYN ++P+SGK+LTGGVDANALQRPKRF
Sbjct: 241 QVAEMVLEKAKRLVEHKKDVVILLDSITRLARAYNTVVPASGKVLTGGVDANALQRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTIIGTALVDTGSRMD+VI+EEFKGTGN E+ L+R++A+KRI+PA+++
Sbjct: 301 FGAARNIEEGGSLTIIGTALVDTGSRMDDVIYEEFKGTGNCELHLDRRMAEKRIYPAINV 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            KSGTR+E+LL+E+  LQK+++LR+++  M+  +AIEFL+DKLK TK+N DFF SM +
Sbjct: 361 NKSGTRREELLIEKDVLQKIWVLRKLLYPMDDLEAIEFLLDKLKATKNNADFFDSMRR 418


>gi|88797354|ref|ZP_01112944.1| transcription termination factor Rho [Reinekea sp. MED297]
 gi|88780223|gb|EAR11408.1| transcription termination factor Rho [Reinekea sp. MED297]
          Length = 418

 Score =  567 bits (1462), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 270/416 (64%), Positives = 347/416 (83%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L +LK K+  +LL  A+S+ +EN N  RKQ+L+F+ILK  +    +I G+GV+E+LQD
Sbjct: 1   MNLSDLKTKAVPELLDIAKSMGLENINRTRKQDLIFTILKRHAKSGEDIYGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS  A+YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P++GERYFALLKV+ IN
Sbjct: 61  GFGFLRSASASYLAGPDDIYVSPSQIRRFNLRTGDTIAGKIRPPKDGERYFALLKVDTIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           F   E+ +NKI F+NLTPL+PD R  +E  N  ++D++ R++DL +PIGKGQR LIV+PP
Sbjct: 121 FAPLEKAKNKILFENLTPLFPDDRLVLEAGNGSSEDMAGRILDLASPIGKGQRGLIVSPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT++LQN+A +I ++ P+ YL+VLLIDERPEEVT+MQRSV+GEVI+STFDE  ARHV
Sbjct: 181 KAGKTLMLQNVAQAITRDAPDAYLMVLLIDERPEEVTEMQRSVRGEVIASTFDEPPARHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DV+ILLDSITRL RAYN ++PSSGK+LTGGVDANAL+RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVIILLDSITRLARAYNTIVPSSGKVLTGGVDANALERPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TALVDTGS+MDEVI+EEFKGTGN E+ L+RKIA+KRIFPA++I
Sbjct: 301 FGAARNVEEGGSLTIIATALVDTGSKMDEVIYEEFKGTGNMEVHLDRKIAEKRIFPAINI 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSM 419
            +SGTR+ED+L    +LQ++++LR++++ M+   AIEFLI+KLK TK N +FF SM
Sbjct: 361 RRSGTRREDMLTSESELQRMWILRKLLAEMDDVAAIEFLINKLKLTKSNDEFFKSM 416


>gi|52843128|ref|YP_096927.1| transcription termination factor Rho [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|52630239|gb|AAU28980.1| transcription termination factor Rho [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
          Length = 423

 Score =  567 bits (1462), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 268/422 (63%), Positives = 344/422 (81%)

Query: 1   MSEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEV 60
           M  M L ELK      L+  A+ + +EN + MRKQ+++F+ILK  + +  +I G+GV+EV
Sbjct: 1   MRSMNLSELKQLPIADLVNIAQEMGVENTSRMRKQDIIFAILKAHALKGEDIHGDGVLEV 60

Query: 61  LQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVN 120
           L DGFGFLRS D +YLAGPDDIYVSPSQI+ F L++GDT+ G IR P++ ERYFALLKV+
Sbjct: 61  LTDGFGFLRSADGSYLAGPDDIYVSPSQIRRFGLRSGDTISGKIRPPKDSERYFALLKVD 120

Query: 121 AINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIV 180
            IN+D P+  + KI F+NLTPL+  +R  ME  N   +D+++RV+DL AP G+GQR LIV
Sbjct: 121 QINYDTPDSAKRKILFENLTPLFATERLVMEQGNGSTEDLTARVVDLCAPFGRGQRGLIV 180

Query: 181 APPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAA 240
           +PP+ GKT++LQNIA SI+KN+PECYLIVLLIDERPEEVT+MQRSV+GEV++STFDE A 
Sbjct: 181 SPPKAGKTLMLQNIARSIEKNYPECYLIVLLIDERPEEVTEMQRSVKGEVVASTFDEPAN 240

Query: 241 RHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRP 300
           RHVQVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++P+SGK+LTGGVDANALQRP
Sbjct: 241 RHVQVAEMVIEKAKRLVEHKRDVVILLDSITRLARAYNTVVPASGKVLTGGVDANALQRP 300

Query: 301 KRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPA 360
           KR +GAARNI+EGGSLTII TALVDTGS+MDEVI+EEFKGTGN EI L R IA++R+FPA
Sbjct: 301 KRLYGAARNIEEGGSLTIIATALVDTGSKMDEVIYEEFKGTGNMEIHLSRNIAERRVFPA 360

Query: 361 MDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           ++I +SGTR+EDLL+  ++LQ+ ++LR+I+ SM+  DAIEFL++++K  K N +FF +M 
Sbjct: 361 ININRSGTRREDLLLSPEELQRTWILRKILQSMDECDAIEFLLERMKNHKTNAEFFDAMK 420

Query: 421 KQ 422
           +Q
Sbjct: 421 RQ 422


>gi|89093775|ref|ZP_01166721.1| transcription termination factor Rho [Oceanospirillum sp. MED92]
 gi|89081905|gb|EAR61131.1| transcription termination factor Rho [Oceanospirillum sp. MED92]
          Length = 419

 Score =  567 bits (1462), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 268/419 (63%), Positives = 348/419 (83%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK KS  +LL  A+ + ++N    RKQ+++F+ILK  +    +I G GV+E+LQD
Sbjct: 1   MNLTELKTKSVPELLEIAKGMGMDNLARSRKQDVIFAILKRHAKGGEDIYGNGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P++GERYFALLKVN IN
Sbjct: 61  GFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTIAGKIRPPKDGERYFALLKVNEIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           +D P+  +NKI F+NLTPL+   R  ME+ N   +D+++RVIDL+ P+GKGQR+L+V+PP
Sbjct: 121 YDKPDNAKNKILFENLTPLFAQDRLRMEIGNGSTEDLTARVIDLVCPMGKGQRALVVSPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT++LQNIA+SI +N+PE +LIVLLIDERPEEVT+MQR+V+GEV++STFDE  +RHV
Sbjct: 181 KAGKTLMLQNIANSITRNNPETHLIVLLIDERPEEVTEMQRTVRGEVVASTFDEPPSRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK L E+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDA+AL+RPKRF
Sbjct: 241 QVAEMVIEKAKRLTEHKKDVVILLDSITRLARAYNTVIPSSGKVLTGGVDAHALERPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TALVDTGS+MDEVIFEEFKGTGNSE+ L+RK+A+KR+FPA++I
Sbjct: 301 FGAARNIEEGGSLTIIATALVDTGSKMDEVIFEEFKGTGNSEVHLDRKVAEKRVFPAINI 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQ 422
            +SGTR+EDLL   ++LQ++++LR+++  M  + A EF+IDKLK  K N +FF SM ++
Sbjct: 361 RRSGTRREDLLTSEEELQRMWILRKLLDPMEDTAATEFVIDKLKDFKTNDEFFLSMKRK 419


>gi|113968753|ref|YP_732546.1| transcription termination factor Rho [Shewanella sp. MR-4]
 gi|114049103|ref|YP_739653.1| transcription termination factor Rho [Shewanella sp. MR-7]
 gi|117918865|ref|YP_868057.1| transcription termination factor Rho [Shewanella sp. ANA-3]
 gi|113883437|gb|ABI37489.1| transcription termination factor Rho [Shewanella sp. MR-4]
 gi|113890545|gb|ABI44596.1| transcription termination factor Rho [Shewanella sp. MR-7]
 gi|117611197|gb|ABK46651.1| transcription termination factor Rho [Shewanella sp. ANA-3]
          Length = 421

 Score =  567 bits (1462), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 274/418 (65%), Positives = 341/418 (81%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK+   + L++ AE++++EN    RKQ+++FSILK  +    +I G GV+E+LQD
Sbjct: 1   MNLTELKDTPISDLVSLAENMKLENMARARKQDIIFSILKAHAKSGEDIFGGGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D +YLAGPDDIYVSPSQI+ F+++TGDT+ G IR P+EGERYFALLKVN +N
Sbjct: 61  GFGFLRSADGSYLAGPDDIYVSPSQIRRFNMRTGDTIFGKIRPPKEGERYFALLKVNEVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           FD PE  RNKI F+NLTPL+ ++R  ME  N   +DI++R++DL +PIGKGQR LIVAPP
Sbjct: 121 FDKPENSRNKILFENLTPLHAEERMRMERGNGSTEDITARILDLCSPIGKGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA SI  N+PE  L+VLLIDERPEEVT+MQR VQGEVI+STFDE A+RHV
Sbjct: 181 KAGKTLLLQNIAQSITYNNPEVVLMVLLIDERPEEVTEMQRLVQGEVIASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANAL RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVIPSSGKVLTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+ GGSLTII TALVDTGS+MDEVI+EEFKGTGN E+ L RK A+KR+FPA+D 
Sbjct: 301 FGAARNIENGGSLTIIATALVDTGSKMDEVIYEEFKGTGNQELHLSRKAAEKRVFPAIDF 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            +SGTR+E+ L    +LQK+++LR+I++ M+   A+EFLIDKL  TK N++FF +M +
Sbjct: 361 NRSGTRREEKLTTPDELQKMWILRKILNPMDEVSAMEFLIDKLAMTKTNEEFFTAMKR 418


>gi|270158326|ref|ZP_06186983.1| transcription termination factor Rho [Legionella longbeachae
           D-4968]
 gi|289163428|ref|YP_003453566.1| transcription termination factor Rho [Legionella longbeachae
           NSW150]
 gi|269990351|gb|EEZ96605.1| transcription termination factor Rho [Legionella longbeachae
           D-4968]
 gi|288856601|emb|CBJ10408.1| transcription termination factor Rho [Legionella longbeachae
           NSW150]
          Length = 420

 Score =  567 bits (1461), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 270/419 (64%), Positives = 342/419 (81%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK      L   A+ + +EN + MRKQE++F+ILK  + +  +I G+GV+EVL D
Sbjct: 1   MNLSELKQLPIADLFNIAQEIGVENPSRMRKQEIIFAILKAHALKGEDIHGDGVLEVLTD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D +YLAGPDDIYVSPSQI+ F L++GDT+ G IR P++ ERYFALLKV+ IN
Sbjct: 61  GFGFLRSADGSYLAGPDDIYVSPSQIRRFGLRSGDTISGKIRPPKDNERYFALLKVDEIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           +D P+  + KI F+NLTPL+  +R  ME  N   +D+++RV+DL AP G+GQR LIV+PP
Sbjct: 121 YDSPDSAKRKILFENLTPLFATQRLVMEQGNGSTEDLTARVVDLCAPFGRGQRGLIVSPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT++LQNIA SI+KN+PECYLIVLLIDERPEEVT+MQRSV+GEV++STFDE A RHV
Sbjct: 181 KAGKTLMLQNIARSIEKNYPECYLIVLLIDERPEEVTEMQRSVKGEVVASTFDEPANRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRPKR 
Sbjct: 241 QVAEMVIEKAKRLVEHKRDVVILLDSITRLARAYNTVIPSSGKVLTGGVDANALQRPKRL 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           +GAARNI+EGGSLTII TALVDTGS+MDEVI+EEFKGTGN EI L R IA++R+FPA++I
Sbjct: 301 YGAARNIEEGGSLTIIATALVDTGSKMDEVIYEEFKGTGNMEIHLSRNIAERRVFPAINI 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQ 422
            +SGTR+EDLL+  +DLQ+ ++LR+I+ SM+  DAIEFL++++K  K N +FF +M +Q
Sbjct: 361 NRSGTRREDLLLSPEDLQRTWILRKILQSMDECDAIEFLLERMKNHKTNAEFFDAMKRQ 419


>gi|198282943|ref|YP_002219264.1| transcription termination factor Rho [Acidithiobacillus
           ferrooxidans ATCC 53993]
 gi|218665961|ref|YP_002425146.1| transcription termination factor Rho [Acidithiobacillus
           ferrooxidans ATCC 23270]
 gi|198247464|gb|ACH83057.1| transcription termination factor Rho [Acidithiobacillus
           ferrooxidans ATCC 53993]
 gi|218518174|gb|ACK78760.1| transcription termination factor Rho [Acidithiobacillus
           ferrooxidans ATCC 23270]
          Length = 418

 Score =  567 bits (1461), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 264/418 (63%), Positives = 344/418 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L +LK K+   L    + + +E     +KQE++F+ILK  +     I GEGV+E+LQD
Sbjct: 1   MNLTDLKRKTAADLAVICQDMGLEGTARQKKQEIIFNILKAHARNGDAIYGEGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLR+   +Y+AGPDDIYVSPSQ++ F L+TGDTV G IR P+EGERYFALLKV +IN
Sbjct: 61  GFGFLRAASGSYMAGPDDIYVSPSQVRRFHLQTGDTVSGQIRPPKEGERYFALLKVESIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           F+ PE  RNK++FD+LTPL+PD+R  +E +     +++ R+IDL++PIGKGQR LIVAPP
Sbjct: 121 FEAPEATRNKVNFDDLTPLFPDERLRLEYDAVPYGEMAPRIIDLVSPIGKGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           +TGKT+LLQ IAH+I  NHPECYLIVLLIDERPEEVT+MQRSV+GEV+SSTFDE A RH 
Sbjct: 181 KTGKTVLLQQIAHAITANHPECYLIVLLIDERPEEVTEMQRSVKGEVVSSTFDEPATRHT 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAE+V+ KAK LVE+  DVVILLDSITRL RA+N ++PSSGK+LTGGVDANALQ+PKRF
Sbjct: 241 QVAEIVLEKAKRLVEHKHDVVILLDSITRLARAFNTVVPSSGKVLTGGVDANALQKPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TALV+TGS+MDEVIFEEFKGTGN E+ L+R++A+KR +PA+++
Sbjct: 301 FGAARNIEEGGSLTIIATALVETGSKMDEVIFEEFKGTGNMEVHLDRRLAEKRTYPAINL 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            KSGTR+E+LLV  + L K+++LR++++ M+  +++EFL+DK++ TK+N +FF SMN+
Sbjct: 361 NKSGTRREELLVPAEMLSKMWVLRKLLAPMDPVESMEFLLDKVRSTKNNAEFFDSMNR 418


>gi|34497040|ref|NP_901255.1| transcription termination factor Rho [Chromobacterium violaceum
           ATCC 12472]
 gi|81834688|sp|Q7NXP1|RHO_CHRVO RecName: Full=Transcription termination factor Rho; AltName:
           Full=ATP-dependent helicase Rho
 gi|34330324|gb|AAQ59261.2| transcription termination factor rho [Chromobacterium violaceum
           ATCC 12472]
          Length = 418

 Score =  567 bits (1461), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 268/418 (64%), Positives = 350/418 (83%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L +LK+   ++L+  A S EI+ AN +RKQ+L+F++LK  + +   I GEG +EVL D
Sbjct: 1   MHLSDLKHLHVSELVEMAISNEIDGANRLRKQDLIFALLKNQAKKGESIFGEGTLEVLPD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSPD +YLAGPDDIYVSPSQI+ F+L TGD++EG IR P++GERYFAL+KV+ +N
Sbjct: 61  GFGFLRSPDTSYLAGPDDIYVSPSQIRRFNLHTGDSIEGEIRTPKDGERYFALVKVDKVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
            + PE  ++KI F+NLTPL+P ++F +E      ++I+ R+IDLI+PIGKGQR+L+VAPP
Sbjct: 121 GEAPENSKHKILFENLTPLFPTEQFKLEREIRAEENITGRIIDLISPIGKGQRALLVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           ++GKT++LQ+IAH+I  NHPE  LIVLLIDERPEEVT+MQRSV+GEV+SSTFDE A RHV
Sbjct: 181 KSGKTVMLQHIAHAITANHPEAVLIVLLIDERPEEVTEMQRSVRGEVVSSTFDEPATRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++P+SGK+LTGGVDANALQRPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVVPASGKVLTGGVDANALQRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTI+ TAL+DTGSRMD+VI+EEFKGTGNSEI L+R++A+KRIFPA++I
Sbjct: 301 FGAARNVEEGGSLTIVATALIDTGSRMDDVIYEEFKGTGNSEIHLDRRMAEKRIFPALNI 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            +SGTR+E+LLV +  LQ++++LR+++  M+  +A+EFL DK+K TK N+ FF SM +
Sbjct: 361 NRSGTRREELLVPQDQLQRIWVLRKLLYPMDDLEAMEFLQDKIKATKSNQAFFDSMRR 418


>gi|254490406|ref|ZP_05103594.1| transcription termination factor Rho [Methylophaga thiooxidans
           DMS010]
 gi|224464393|gb|EEF80654.1| transcription termination factor Rho [Methylophaga thiooxydans
           DMS010]
          Length = 419

 Score =  567 bits (1460), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 267/418 (63%), Positives = 349/418 (83%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK +S  +L+  A S+ +E     RKQEL+F+I+K  S +  +++  GV+E+L D
Sbjct: 1   MNLTELKKQSAAELMDLALSMNLEGLARNRKQELIFAIVKAHSKQGEDVVTTGVLELLPD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSP+ +Y+AGPDD+YVSPSQI+ F L+TGDT+ G IR P++ ERYFAL+KV  IN
Sbjct: 61  GFGFLRSPEDSYIAGPDDVYVSPSQIRRFHLRTGDTIMGKIRPPKDSERYFALVKVEEIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           ++ P++ RNK+ F+NLTPL+P++RFN+E  N   +D+++RVIDL APIGKGQR LIVAPP
Sbjct: 121 YEKPDKSRNKVPFENLTPLFPNERFNLERGNGSTEDLTARVIDLAAPIGKGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           ++GKT++LQ+IA SI  N+P+  LIVLLIDERPEEVT+MQRSV+GEV+SSTFDE A+RHV
Sbjct: 181 KSGKTMILQSIAQSIALNYPDSDLIVLLIDERPEEVTEMQRSVRGEVVSSTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN + PSSGK+LTGGVDANALQRPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKHDVVILLDSITRLARAYNTVSPSSGKVLTGGVDANALQRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TAL++TGSRMDEVIFEEFKGTGN+E++LERK+AD+R++PA+++
Sbjct: 301 FGAARNIEEGGSLTIIATALIETGSRMDEVIFEEFKGTGNNEVLLERKLADRRMYPAINV 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            +SGTR+E+LL   +DLQK+++LR+I+  M   +++EFL+++LK TK N +FF SM +
Sbjct: 361 TRSGTRREELLTNEEDLQKLWILRKILGPMEPVESMEFLMERLKSTKTNLEFFDSMKQ 418


>gi|126176120|ref|YP_001052269.1| transcription termination factor Rho [Shewanella baltica OS155]
 gi|160877175|ref|YP_001556491.1| transcription termination factor Rho [Shewanella baltica OS195]
 gi|217975025|ref|YP_002359776.1| transcription termination factor Rho [Shewanella baltica OS223]
 gi|304412474|ref|ZP_07394080.1| transcription termination factor Rho [Shewanella baltica OS183]
 gi|307307133|ref|ZP_07586871.1| transcription termination factor Rho [Shewanella baltica BA175]
 gi|125999325|gb|ABN63400.1| transcription termination factor Rho [Shewanella baltica OS155]
 gi|160862697|gb|ABX51231.1| transcription termination factor Rho [Shewanella baltica OS195]
 gi|217500160|gb|ACK48353.1| transcription termination factor Rho [Shewanella baltica OS223]
 gi|304349116|gb|EFM13528.1| transcription termination factor Rho [Shewanella baltica OS183]
 gi|306910372|gb|EFN40803.1| transcription termination factor Rho [Shewanella baltica BA175]
 gi|315269379|gb|ADT96232.1| transcription termination factor Rho [Shewanella baltica OS678]
          Length = 421

 Score =  567 bits (1460), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 272/418 (65%), Positives = 342/418 (81%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK+   + L++ AE++++EN    RKQ+++FSILK  +    +I G GV+E+LQD
Sbjct: 1   MNLTELKDTPISDLVSLAENMKLENMARARKQDIIFSILKAHAKSGEDIFGGGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D +YLAGPDDIYVSPSQI+ F+++TGDT+ G IR P+EGERYFALLKVN +N
Sbjct: 61  GFGFLRSSDGSYLAGPDDIYVSPSQIRRFNMRTGDTIFGKIRPPKEGERYFALLKVNEVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           FD PE  RNKI F+NLTPL+ ++R  ME  N   +DI++R++DL +PIGKGQR LIVAPP
Sbjct: 121 FDKPENSRNKILFENLTPLHAEERMRMERGNGSTEDITARILDLCSPIGKGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQ IA SI  N+PE  L+VLLIDERPEEVT+MQR V+GEVI+STFDE A+RHV
Sbjct: 181 KAGKTLLLQGIAQSISYNNPEVVLMVLLIDERPEEVTEMQRLVKGEVIASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANAL RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVIPSSGKVLTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+ GGSLTII TALVDTGS+MDEVI+EEFKGTGN E+ L RK A+KR+FPA+D 
Sbjct: 301 FGAARNIEHGGSLTIIATALVDTGSKMDEVIYEEFKGTGNQELHLSRKAAEKRVFPAIDF 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            +SGTR+E+ L  +++LQK+++LR+I++ M+   A+EFLIDKL  TK N++FF +M +
Sbjct: 361 NRSGTRREEKLTTQEELQKMWILRKILNPMDEVSAMEFLIDKLAMTKTNEEFFTAMKR 418


>gi|94676908|ref|YP_588645.1| transcription termination factor Rho [Baumannia cicadellinicola
           str. Hc (Homalodisca coagulata)]
 gi|94220058|gb|ABF14217.1| transcription termination factor Rho [Baumannia cicadellinicola
           str. Hc (Homalodisca coagulata)]
          Length = 419

 Score =  566 bits (1459), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 272/418 (65%), Positives = 340/418 (81%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELKN   ++L+   E + +EN   MRKQ+++F+ LK  +    +I G+GV+E+LQD
Sbjct: 1   MNLTELKNTPVSELIIIGEKMGLENIARMRKQDIIFATLKQHAKSGEDIFGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P+EGERYFALLKVN +N
Sbjct: 61  GFGFLRSSDSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNEVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           +D PE  RNKI F+NLTPL+ + R  ME  N   +D+++RV+DL +PIG GQR LIVAPP
Sbjct: 121 YDKPENARNKILFENLTPLHANLRLRMERGNGSTEDLTARVLDLASPIGCGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+L+QNIA SI  N+P C LIVLLIDERPEEVT+MQR V+GEVI+STFDE AARHV
Sbjct: 181 KAGKTMLMQNIAQSITYNYPNCVLIVLLIDERPEEVTEMQRLVKGEVIASTFDEPAARHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DV+ILLDSITRL RAYN ++P+SGK+LTGGVDANAL RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVMILLDSITRLARAYNTVVPASGKVLTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TAL+DTGS+MDEVI+EEFKGTGN E+ L RKIA+KR+FPA+D 
Sbjct: 301 FGAARNIEEGGSLTIIATALIDTGSKMDEVIYEEFKGTGNMELHLSRKIAEKRVFPAIDY 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            +SGTRKE+LL  +++LQK+++LR+I+  M   DA+EFL++KL  TK N +FF  M +
Sbjct: 361 NRSGTRKEELLTTQEELQKMWILRKIIHPMCEIDAMEFLMNKLAMTKTNDEFFDMMKR 418


>gi|56461461|ref|YP_156742.1| transcription termination factor Rho [Idiomarina loihiensis L2TR]
 gi|56180471|gb|AAV83193.1| Transcription termination factor rho [Idiomarina loihiensis L2TR]
          Length = 422

 Score =  566 bits (1459), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 270/419 (64%), Positives = 343/419 (81%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK+K   +L+  A+S+ +EN   +RKQ+++F+ILK  +    +I G GV+E+LQD
Sbjct: 1   MNLTELKDKPVNELVQLADSMGLENMARLRKQDIIFAILKAHAKSGEDIHGGGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P++ ERYFALLK+  +N
Sbjct: 61  GFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTIGGKIRPPKDSERYFALLKIREVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           FD PE  RNKI F+NLTPL+ ++RF++E  N   +DI++RV+DL APIGKGQR LIVAPP
Sbjct: 121 FDKPENSRNKILFENLTPLHAEERFHLERGNGSKEDITARVLDLSAPIGKGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA SI  NHP+  LIVLLIDERPEEVT+M R V GEV++STFDE A+RHV
Sbjct: 181 KAGKTLLLQNIATSIAANHPDAELIVLLIDERPEEVTEMHRLVHGEVVASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANAL +PKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVIPSSGKVLTGGVDANALHKPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TAL+DTGS+MDEVI+EEFKGTGN E+ L RK+A++R+FPA+D 
Sbjct: 301 FGAARNVEEGGSLTIIATALIDTGSKMDEVIYEEFKGTGNMELHLNRKLAERRVFPAIDF 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQ 422
            +SGTR+E+LL    +LQK+++LR+I+  M   +A+EFLID+L+ TK N +FF SM +Q
Sbjct: 361 NRSGTRREELLTTPDELQKMWILRKIMHPMGEVEAMEFLIDRLQMTKTNDEFFESMKRQ 419


>gi|226946748|ref|YP_002801821.1| transcription termination factor Rho [Azotobacter vinelandii DJ]
 gi|226721675|gb|ACO80846.1| transcription termination factor Rho protein [Azotobacter
           vinelandii DJ]
          Length = 419

 Score =  566 bits (1459), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 275/419 (65%), Positives = 351/419 (83%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK K  T+LL  AE + +EN    RKQ+++FS+LK  +    EI G+GV+E+LQD
Sbjct: 1   MNLTELKQKPITELLEMAEQMGLENMARSRKQDVIFSLLKKHAKSGEEISGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P+EGERYFALLKV++IN
Sbjct: 61  GFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTIVGKIRPPKEGERYFALLKVDSIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           FD PE  +NKI F+NLTPL+P+ R  ME  N   +D++ RVIDL APIGKGQR LIVAPP
Sbjct: 121 FDRPENAKNKILFENLTPLFPNARLTMEAGNGSTEDLTGRVIDLCAPIGKGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKTI+LQNIA +I +N+PEC+LIVLLIDERPEEVT+MQR+V+GEV++STFDE   RHV
Sbjct: 181 KAGKTIMLQNIASNITRNNPECHLIVLLIDERPEEVTEMQRTVRGEVVASTFDEPPTRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDA+AL++PKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVIPSSGKVLTGGVDAHALEKPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTI+ TALV+TGS+MDEVI+EEFKGTGN E+ L+R++A+KR+FPA++I
Sbjct: 301 FGAARNIEEGGSLTILATALVETGSKMDEVIYEEFKGTGNLELQLDRRVAEKRVFPAINI 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQ 422
            +SGTR+E+LL   ++LQ++++LR+I+  M+   AIEFL+D+LK TK N++FF SM ++
Sbjct: 361 NRSGTRREELLTGEEELQRMWILRKILHPMDEIAAIEFLLDRLKDTKTNEEFFQSMKRK 419


>gi|120597336|ref|YP_961910.1| transcription termination factor Rho [Shewanella sp. W3-18-1]
 gi|146294519|ref|YP_001184943.1| transcription termination factor Rho [Shewanella putrefaciens
           CN-32]
 gi|153002456|ref|YP_001368137.1| transcription termination factor Rho [Shewanella baltica OS185]
 gi|120557429|gb|ABM23356.1| transcription termination factor Rho [Shewanella sp. W3-18-1]
 gi|145566209|gb|ABP77144.1| transcription termination factor Rho [Shewanella putrefaciens
           CN-32]
 gi|151367074|gb|ABS10074.1| transcription termination factor Rho [Shewanella baltica OS185]
 gi|319427884|gb|ADV55958.1| transcription termination factor Rho [Shewanella putrefaciens 200]
          Length = 421

 Score =  566 bits (1459), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 272/418 (65%), Positives = 342/418 (81%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK+   + L++ AE++++EN    RKQ+++FSILK  +    +I G GV+E+LQD
Sbjct: 1   MNLTELKDTPISDLVSLAENMKLENMARARKQDIIFSILKAHAKSGEDIFGGGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D +YLAGPDDIYVSPSQI+ F+++TGDT+ G IR P+EGERYFALLKVN +N
Sbjct: 61  GFGFLRSSDGSYLAGPDDIYVSPSQIRRFNMRTGDTIFGKIRPPKEGERYFALLKVNEVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           FD PE  RNKI F+NLTPL+ ++R  ME  N   +DI++R++DL +PIGKGQR LIVAPP
Sbjct: 121 FDKPENSRNKILFENLTPLHAEERMRMERGNGSTEDITARILDLCSPIGKGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQ IA SI  N+PE  L+VLLIDERPEEVT+MQR V+GEVI+STFDE A+RHV
Sbjct: 181 KAGKTLLLQGIAQSISYNNPEVVLMVLLIDERPEEVTEMQRLVKGEVIASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANAL RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVIPSSGKVLTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+ GGSLTII TALVDTGS+MDEVI+EEFKGTGN E+ L RK A+KR+FPA+D 
Sbjct: 301 FGAARNIEHGGSLTIIATALVDTGSKMDEVIYEEFKGTGNQELHLSRKAAEKRVFPAIDF 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            +SGTR+E+ L  +++LQK+++LR+I++ M+   A+EFLIDKL  TK N++FF +M +
Sbjct: 361 NRSGTRREEKLTTQEELQKMWILRKILNPMDEVSAMEFLIDKLAMTKTNEEFFTAMKR 418


>gi|92112717|ref|YP_572645.1| transcription termination factor Rho [Chromohalobacter salexigens
           DSM 3043]
 gi|91795807|gb|ABE57946.1| transcription termination factor Rho [Chromohalobacter salexigens
           DSM 3043]
          Length = 419

 Score =  566 bits (1459), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 268/419 (63%), Positives = 348/419 (83%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK K+  +LL  A  + I+N    RKQ+++F+ILK  +    +I G+GV+E+LQD
Sbjct: 1   MNLTELKQKTVPELLDIAREMGIDNLARSRKQDIIFAILKKHAKSGEDIYGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+ GD++ G IR P+EGERYFALLKVN IN
Sbjct: 61  GFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRKGDSIAGKIRPPKEGERYFALLKVNEIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           FD PE  ++KI F+NLTPL+P +R  ME+ N   +D++SRVIDL +PIGKGQR LIV+PP
Sbjct: 121 FDRPENAKHKILFENLTPLFPQERMVMEIGNGSTEDLTSRVIDLTSPIGKGQRGLIVSPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT++LQNIA SI +N+PEC+LIVLLIDERPEEVT+M R+V+GEV++STFDE  ARHV
Sbjct: 181 KAGKTLMLQNIATSITRNNPECHLIVLLIDERPEEVTEMSRTVRGEVVASTFDEPPARHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVV+LLDSITRL RAYN ++PSSGK+LTGGVDA+AL++PKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKRDVVVLLDSITRLARAYNTVVPSSGKVLTGGVDAHALEKPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TALVDTGS+MDEVIFEEFKGTGN E  L+RK+A+KR++PA++I
Sbjct: 301 FGAARNIEEGGSLTIIATALVDTGSKMDEVIFEEFKGTGNMEAHLDRKLAEKRVYPALNI 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQ 422
            +SGTR+EDL+   +++Q++++LR++++ M+   A EFLID+LK TK N +FF +M ++
Sbjct: 361 RRSGTRREDLIASEEEMQRMWILRKLLNPMDDVAATEFLIDRLKDTKTNIEFFEAMKRR 419


>gi|192362115|ref|YP_001980885.1| transcription termination factor Rho [Cellvibrio japonicus Ueda107]
 gi|190688280|gb|ACE85958.1| transcription termination factor Rho [Cellvibrio japonicus Ueda107]
          Length = 419

 Score =  566 bits (1459), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 273/419 (65%), Positives = 347/419 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L +LK K   +L+  A  + +EN    RKQ+++F+ILK  +    +I G+GV+E+L D
Sbjct: 1   MNLTDLKKKPIEELIDIAHGMGLENIARSRKQDIIFNILKRHAKGGEDIYGDGVLEILVD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P+EGERYFALLKVN IN
Sbjct: 61  GFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNDIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           FD PE  RNKI F+NLTPL+P++R  +E  N   +D++ R+IDLIAPIGKGQR LIVAPP
Sbjct: 121 FDKPENSRNKILFENLTPLFPNERILLEAGNGSTEDLTGRIIDLIAPIGKGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKTI++QNIA +I +N+PEC+LIVLLIDERPEEVT+MQRSV+GEV++STFDE  ARHV
Sbjct: 181 KAGKTIMMQNIAQAITRNNPECHLIVLLIDERPEEVTEMQRSVRGEVVASTFDEPPARHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVA+MVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDA+AL+RPKRF
Sbjct: 241 QVADMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVIPSSGKVLTGGVDAHALERPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSL+II TALVDTGS+MDEVI+EEFKGTGN E+ L+RK+A+KR++PA++I
Sbjct: 301 FGAARNIEEGGSLSIIATALVDTGSKMDEVIYEEFKGTGNLELHLDRKLAEKRVYPAINI 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQ 422
            +SGTR+EDLL++  + Q+V++LRR+++ M    A EFLIDKLK  K N +FF SM ++
Sbjct: 361 RRSGTRREDLLMKEDEQQRVWILRRLLNDMEDIAATEFLIDKLKDFKTNDEFFLSMKRK 419


>gi|119475468|ref|ZP_01615821.1| transcription termination factor Rho [marine gamma proteobacterium
           HTCC2143]
 gi|119451671|gb|EAW32904.1| transcription termination factor Rho [marine gamma proteobacterium
           HTCC2143]
          Length = 419

 Score =  566 bits (1459), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 269/419 (64%), Positives = 346/419 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L +LK K   +LL  A+ + I+N    RKQ+++FSILK  +    +I G+GV+E+LQD
Sbjct: 1   MNLTDLKTKPTQELLDIAKEIGIDNIARQRKQDIIFSILKRHAKSGEDISGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D +YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P++GERYFALLKV+ +N
Sbjct: 61  GFGFLRSADCSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKDGERYFALLKVSEVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           +  PE+ RNK+ F+NLTPL+PD+R  +E  N   +D++ R+IDL APIGKG R LIVAPP
Sbjct: 121 YTQPEQSRNKVLFENLTPLFPDERCVLEAGNGSTEDLTGRIIDLAAPIGKGVRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT++LQ+IA SI +N+PECY+IVLLIDERPEEVTDMQRSV+ EV++STFDE   RHV
Sbjct: 181 KAGKTLMLQSIAQSIVRNNPECYVIVLLIDERPEEVTDMQRSVRAEVVASTFDEPPTRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDA+AL+RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTIVPSSGKVLTGGVDAHALERPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSL+II TAL+DTGS+MDEVI+EEFKGTGN E+ L+RKIA++R++PA++I
Sbjct: 301 FGAARNIEEGGSLSIIATALIDTGSKMDEVIYEEFKGTGNMELHLDRKIAERRVYPAINI 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQ 422
            +SGTR+E+LL    +LQ++++LR+++ SM  S AIEFL+DKLK TK N +FF SM ++
Sbjct: 361 RRSGTRREELLTSEDELQRMWILRKLLHSMEDSAAIEFLLDKLKDTKTNDEFFMSMKRK 419


>gi|328952409|ref|YP_004369743.1| transcription termination factor Rho [Desulfobacca acetoxidans DSM
           11109]
 gi|328452733|gb|AEB08562.1| transcription termination factor Rho [Desulfobacca acetoxidans DSM
           11109]
          Length = 421

 Score =  566 bits (1458), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 277/418 (66%), Positives = 342/418 (81%), Gaps = 3/418 (0%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK K   +L + A    IE A  +RKQEL+F+IL+  + ++  I GEGV+E+L D
Sbjct: 7   MNLTELKEKKIGELTSLAREFNIEGAAGLRKQELIFAILQAQTEKNGFIYGEGVLEILPD 66

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLR PD NYL GPDDIYVSPSQI+ F+L+TGDTV G IR P+EGERYFALLKV  IN
Sbjct: 67  GFGFLRCPDYNYLPGPDDIYVSPSQIRRFNLRTGDTVSGQIRPPKEGERYFALLKVEHIN 126

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           F+ PE  R+KI FDNLTPLYP++R ++E   P+N   S R++DL+ PIGKGQR LIVA P
Sbjct: 127 FEDPESTRDKILFDNLTPLYPNQRLHLE-TGPDN--FSPRIMDLMTPIGKGQRGLIVAAP 183

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           RTGKT+LLQ+IA+S+  NHPE  LIVLLIDERPEEVTDMQRSV+ EV+SSTFDE A RHV
Sbjct: 184 RTGKTMLLQSIANSVVTNHPEVILIVLLIDERPEEVTDMQRSVKAEVVSSTFDEQAQRHV 243

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMV+ KAK LVE+  DVVILLDSITRL RAYN ++P SGKIL+GGVD+NAL RPKRF
Sbjct: 244 QVAEMVLEKAKRLVEHKRDVVILLDSITRLARAYNTVVPPSGKILSGGVDSNALHRPKRF 303

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGN EI L+RK+ +KRIFP++DI
Sbjct: 304 FGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNMEIHLDRKLVEKRIFPSIDI 363

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            +SGTRKE+LL+ + DL ++++LR+++S +N  D++EFL++K++ TKDN +F  SM++
Sbjct: 364 NRSGTRKEELLLPQDDLNRIWILRKLLSPLNPIDSMEFLLEKMRGTKDNAEFLASMSR 421


>gi|148654107|ref|YP_001281200.1| transcription termination factor Rho [Psychrobacter sp. PRwf-1]
 gi|148573191|gb|ABQ95250.1| transcription termination factor Rho [Psychrobacter sp. PRwf-1]
          Length = 432

 Score =  566 bits (1458), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 270/422 (63%), Positives = 343/422 (81%)

Query: 2   SEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVL 61
           + M L ELK  S  +LL  A+ + ++N    RKQ+++F+ILK  +     I G+GV+EVL
Sbjct: 9   TSMNLTELKKNSVAELLNIAKEMGLDNLARSRKQDIIFAILKKHAKNGEAIYGDGVLEVL 68

Query: 62  QDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNA 121
            DGFGFLRS + +YLAGPDDIYVSPSQI+ FSLKTGD++ G+IR P++ ERYFALLKV  
Sbjct: 69  PDGFGFLRSSEGSYLAGPDDIYVSPSQIRRFSLKTGDSIAGTIRPPKDSERYFALLKVGE 128

Query: 122 INFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVA 181
           INFD P+R R+K+ F+NLTPL+P ++  +E+ N   +D++ RVIDLIAPIGKGQRS+IVA
Sbjct: 129 INFDTPDRSRHKLIFENLTPLFPTEQLKLEMGNGTTEDLTGRVIDLIAPIGKGQRSIIVA 188

Query: 182 PPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAAR 241
           PP+ GKT+LLQ IA SI +N+PECYLIVLLIDERPEEVT+MQR+V+GEV++STFDE   R
Sbjct: 189 PPKAGKTVLLQTIAQSITRNNPECYLIVLLIDERPEEVTEMQRTVRGEVVASTFDEPPQR 248

Query: 242 HVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPK 301
           HVQVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANAL +PK
Sbjct: 249 HVQVAEMVIEKAKRLVEHKQDVVILLDSITRLARAYNTVVPSSGKVLTGGVDANALAQPK 308

Query: 302 RFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAM 361
           RFFGAARNI+EGGSLTII TAL+DTGS+MD VIFEEFKGTGN EI LER +A+KR+FPA+
Sbjct: 309 RFFGAARNIEEGGSLTIISTALIDTGSKMDSVIFEEFKGTGNQEITLERDLAEKRVFPAI 368

Query: 362 DIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
           +I KSGTR+E+ L++   L+KV++LR+++  M+   A EFL+D+LK+ K N DFF  M +
Sbjct: 369 NIKKSGTRREERLLDEDTLRKVWILRKLLQPMDGVQATEFLLDRLKEAKTNDDFFDQMKR 428

Query: 422 QN 423
           ++
Sbjct: 429 KS 430


>gi|319944211|ref|ZP_08018487.1| transcription termination factor rho [Lautropia mirabilis ATCC
           51599]
 gi|319742506|gb|EFV94917.1| transcription termination factor rho [Lautropia mirabilis ATCC
           51599]
          Length = 419

 Score =  565 bits (1457), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 272/421 (64%), Positives = 349/421 (82%), Gaps = 5/421 (1%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK    ++L+  A+SLEIE AN +RKQELMF+ILK  +    +I G+GV+EVL D
Sbjct: 1   MYLSELKALHISRLIEIAQSLEIEAANRLRKQELMFAILKRKARNGDQIFGDGVLEVLPD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLR+P+ +YLA PDDIY+SPSQI+ F+L TGD++EG +R P++GERYFAL+KV+ IN
Sbjct: 61  GFGFLRTPETSYLASPDDIYISPSQIRRFNLHTGDSIEGEVRTPKDGERYFALVKVDRIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPE---NKDISSRVIDLIAPIGKGQRSLIV 180
              PE  ++KI F+NLTPL+PD+   +E   P+   +++++ R+ID+IAPIGKGQR LIV
Sbjct: 121 GAPPEHSKHKILFENLTPLHPDEVLRLE--RPDLLTDENVTGRIIDIIAPIGKGQRGLIV 178

Query: 181 APPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAA 240
           APP++GKT+++Q+IAH+I  NHP+  +IVLLIDERPEEVT+MQRS++GEV+SSTFDE A 
Sbjct: 179 APPKSGKTVMMQHIAHAITTNHPDAVVIVLLIDERPEEVTEMQRSIRGEVVSSTFDEPAT 238

Query: 241 RHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRP 300
           RHVQVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRP
Sbjct: 239 RHVQVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVVPSSGKVLTGGVDANALQRP 298

Query: 301 KRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPA 360
           KRFFGAARNI+EGGSLTI+ TAL+DTGSRMDEVI+EEFKGTGN EI L R++ +KRIFPA
Sbjct: 299 KRFFGAARNIEEGGSLTILATALIDTGSRMDEVIYEEFKGTGNMEIHLNRRMMEKRIFPA 358

Query: 361 MDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           MDI +SGTR+E+LL++ + LQKV++LRR++  M+   A+EFL+DK+K TK+N +FF  M 
Sbjct: 359 MDINRSGTRREELLIKPEILQKVWILRRLLHDMDELQAMEFLLDKMKATKNNTEFFDMMK 418

Query: 421 K 421
           K
Sbjct: 419 K 419


>gi|54295773|ref|YP_128188.1| transcription termination factor Rho [Legionella pneumophila str.
           Lens]
 gi|54298935|ref|YP_125304.1| transcription termination factor Rho [Legionella pneumophila str.
           Paris]
 gi|148361266|ref|YP_001252473.1| hypothetical protein LPC_3240 [Legionella pneumophila str. Corby]
 gi|296108605|ref|YP_003620306.1| transcription termination factor Rho [Legionella pneumophila
           2300/99 Alcoy]
 gi|53752720|emb|CAH14155.1| transcription termination factor Rho [Legionella pneumophila str.
           Paris]
 gi|53755605|emb|CAH17107.1| transcription termination factor Rho [Legionella pneumophila str.
           Lens]
 gi|148283039|gb|ABQ57127.1| hypothetical protein LPC_3240 [Legionella pneumophila str. Corby]
 gi|295650507|gb|ADG26354.1| transcription termination factor Rho [Legionella pneumophila
           2300/99 Alcoy]
 gi|307611822|emb|CBX01535.1| transcription termination factor Rho [Legionella pneumophila 130b]
          Length = 420

 Score =  565 bits (1456), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 267/419 (63%), Positives = 343/419 (81%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK      L+  A+ + +EN + MRKQ+++F+ILK  + +  +I G+GV+EVL D
Sbjct: 1   MNLSELKQLPIADLVNIAQEMGVENTSRMRKQDIIFAILKAHALKGEDIHGDGVLEVLTD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D +YLAGPDDIYVSPSQI+ F L++GDT+ G IR P++ ERYFALLKV+ IN
Sbjct: 61  GFGFLRSADGSYLAGPDDIYVSPSQIRRFGLRSGDTISGKIRPPKDSERYFALLKVDQIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           +D P+  + KI F+NLTPL+  +R  ME  N   +D+++RV+DL AP G+GQR LIV+PP
Sbjct: 121 YDTPDSAKRKILFENLTPLFATERLVMEQGNGSTEDLTARVVDLCAPFGRGQRGLIVSPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT++LQNIA SI+KN+PECYLIVLLIDERPEEVT+MQRSV+GEV++STFDE A RHV
Sbjct: 181 KAGKTLMLQNIARSIEKNYPECYLIVLLIDERPEEVTEMQRSVKGEVVASTFDEPANRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++P+SGK+LTGGVDANALQRPKR 
Sbjct: 241 QVAEMVIEKAKRLVEHKRDVVILLDSITRLARAYNTVVPASGKVLTGGVDANALQRPKRL 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           +GAARNI+EGGSLTII TALVDTGS+MDEVI+EEFKGTGN EI L R IA++R+FPA++I
Sbjct: 301 YGAARNIEEGGSLTIIATALVDTGSKMDEVIYEEFKGTGNMEIHLSRNIAERRVFPAINI 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQ 422
            +SGTR+EDLL+  ++LQ+ ++LR+I+ SM+  DAIEFL++++K  K N +FF +M +Q
Sbjct: 361 NRSGTRREDLLLSPEELQRTWILRKILQSMDECDAIEFLLERMKNHKTNAEFFDAMKRQ 419


>gi|24372001|ref|NP_716043.1| transcription termination factor Rho [Shewanella oneidensis MR-1]
 gi|24345862|gb|AAN53488.1|AE015489_1 transcription termination factor Rho [Shewanella oneidensis MR-1]
          Length = 421

 Score =  565 bits (1456), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 273/418 (65%), Positives = 340/418 (81%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK+   + L++ AE++++EN    RKQ+++FSILK  +    +I G GV+E+LQD
Sbjct: 1   MNLTELKDTPISDLVSLAENMKLENMARARKQDIIFSILKAHAKSGEDIFGGGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D +YLAGPDDIYVSPSQI+ F+++TGDT+ G IR P+EGERYFALLKVN +N
Sbjct: 61  GFGFLRSADGSYLAGPDDIYVSPSQIRRFNMRTGDTIFGKIRPPKEGERYFALLKVNEVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           FD PE  RNKI F+NLTPL+ ++R  ME  N   +DI++R++DL +PIGKGQR LIVAPP
Sbjct: 121 FDKPENSRNKILFENLTPLHAEERMRMERGNGSTEDITARILDLCSPIGKGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA SI  N+PE  L+VLLIDERPEEVT+MQR V+GEVI+STFDE A+RHV
Sbjct: 181 KAGKTLLLQNIAQSITYNNPEVVLMVLLIDERPEEVTEMQRLVKGEVIASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANAL RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVIPSSGKVLTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+ GGSLTII TALVDTGS+MDEVI+EEFKGTGN E+ L RK A+KR+FPA+D 
Sbjct: 301 FGAARNIENGGSLTIIATALVDTGSKMDEVIYEEFKGTGNQELHLSRKAAEKRVFPAIDF 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            +SGTR+E+ L    +LQK+++LR+I++ M+   A+EFLIDKL  TK N +FF +M +
Sbjct: 361 NRSGTRREEKLTNPDELQKMWILRKILNPMDEVSAMEFLIDKLAMTKTNDEFFTAMKR 418


>gi|30249038|ref|NP_841108.1| transcription termination factor Rho [Nitrosomonas europaea ATCC
           19718]
 gi|30138655|emb|CAD84946.1| rho; Transcription termination factor [Nitrosomonas europaea ATCC
           19718]
          Length = 419

 Score =  565 bits (1456), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 268/418 (64%), Positives = 350/418 (83%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M+L +LK+   ++L+  A + +IE AN MRKQ+L+F++LK  + +   I GEG +E+LQD
Sbjct: 1   MRLSDLKSIHVSELVKMAVANDIEGANRMRKQDLVFALLKNQARKSESIFGEGTLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSPD +YLAGPDDIY+SPSQI+ F+L TGD+V+G IR P+EGERYFAL+K++ +N
Sbjct: 61  GFGFLRSPDTSYLAGPDDIYISPSQIRRFNLHTGDSVDGEIRPPKEGERYFALVKIDKVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
            + PE  + KI F+NLTPL+P +R  +E +    ++I+ R+IDLIAPIGKGQR L+VA P
Sbjct: 121 NEPPENSKRKILFENLTPLFPTERLTLERDIKSEENITGRIIDLIAPIGKGQRGLLVASP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           ++GKT++LQ+IAHSI  NHP+  L+VLLIDERPEEVT+M RSV+GEVISSTFDESAARHV
Sbjct: 181 KSGKTVMLQHIAHSIAANHPDVVLMVLLIDERPEEVTEMVRSVKGEVISSTFDESAARHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVA+MVI KAK LVE+  DVVILLDSITRL RAYN ++P+SGK+LTGGVDANALQRPKRF
Sbjct: 241 QVADMVIEKAKRLVEHKKDVVILLDSITRLARAYNTIVPASGKVLTGGVDANALQRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TALVDTGSRMD+VI+EEFKGTGN EI L+R++A+KRI+PA+++
Sbjct: 301 FGAARNIEEGGSLTIIATALVDTGSRMDDVIYEEFKGTGNMEIHLDRRMAEKRIYPAINV 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            +SGTR+E+LL+  + LQK+++LR+++  M+  DA+ FL+DK+K TK+N DFF SM +
Sbjct: 361 NRSGTRREELLIPSEILQKIWILRKLLYPMDEMDAMSFLLDKIKATKNNADFFDSMRR 418


>gi|114561646|ref|YP_749159.1| transcription termination factor Rho [Shewanella frigidimarina
           NCIMB 400]
 gi|114332939|gb|ABI70321.1| transcription termination factor Rho [Shewanella frigidimarina
           NCIMB 400]
          Length = 420

 Score =  565 bits (1456), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 272/418 (65%), Positives = 340/418 (81%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK+   + L++ AES+ +EN    RKQ+++FSILK  +    +I G GV+E+LQD
Sbjct: 1   MNLTELKDTPISDLVSLAESMNLENMARTRKQDIIFSILKAHAKSGEDIFGGGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D +YLAGPDDIYVSPSQI+ F+++TGD++ G IR P+EGERYFALLKV+ +N
Sbjct: 61  GFGFLRSSDGSYLAGPDDIYVSPSQIRRFNMRTGDSIFGKIRPPKEGERYFALLKVSEVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           FD PE  RNKI F+NLTPL+ ++R  ME  N   +DI+SR++DL +PIGKGQR LIVAPP
Sbjct: 121 FDKPESSRNKILFENLTPLHAEERLRMERGNGSTEDITSRILDLCSPIGKGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA SI  N+P+  L+VLLIDERPEEVT+MQR V+GEVI+STFDE A+RHV
Sbjct: 181 KAGKTLLLQNIAQSITYNNPDVVLMVLLIDERPEEVTEMQRMVKGEVIASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANAL RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVIPSSGKVLTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+ GGSLTII TALVDTGS+MDEVI+EEFKGTGN E+ L RK A+KR+FPA+D 
Sbjct: 301 FGAARNIEHGGSLTIIATALVDTGSKMDEVIYEEFKGTGNQELHLSRKAAEKRVFPAIDF 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            +SGTR+E+ L   ++LQK+++LR+I+  M+   A+EFLIDKL  TK N++FF +M +
Sbjct: 361 NRSGTRREEKLTTPEELQKMWILRKILHPMDEVSAMEFLIDKLAMTKTNEEFFTAMKR 418


>gi|33520025|ref|NP_878857.1| transcription termination factor Rho [Candidatus Blochmannia
           floridanus]
 gi|33504371|emb|CAD83264.1| transcription termination factor Rho [Candidatus Blochmannia
           floridanus]
          Length = 419

 Score =  565 bits (1455), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 267/418 (63%), Positives = 339/418 (81%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L +LKN   ++L+   ES+ +EN   MRKQ+++F+I K  +    +I G+GV+E+LQD
Sbjct: 1   MNLTKLKNIPVSELVTLGESMGLENLARMRKQDIIFAIFKQHAKTGEDIFGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P+EGERYFALLKVN +N
Sbjct: 61  GFGFLRSSDSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNDVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           +D PE  RNKI F+NLTPL+ + R  ME  N   +D+++RV+DL +PIG+GQR LIVAPP
Sbjct: 121 YDKPENARNKILFENLTPLHANSRLRMERGNGSTEDLTARVLDLASPIGRGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA SI  N+P+C L+VLLIDERPEEVT+MQR V GEVI+STFDE A+RHV
Sbjct: 181 KAGKTMLLQNIAQSISHNYPDCVLMVLLIDERPEEVTEMQRLVHGEVIASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QV+EMVI KAK LVE+  DV++LLDSITRL RAYN + PSSGK+LTGGVDANAL RPKRF
Sbjct: 241 QVSEMVIEKAKRLVEHKKDVIVLLDSITRLARAYNTIAPSSGKVLTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTI+ TAL+DTGS+MDEVI+EEFKGTGN E+ L RKIA+KR+FPA+D 
Sbjct: 301 FGAARNMEEGGSLTIVATALIDTGSKMDEVIYEEFKGTGNMELHLSRKIAEKRVFPAIDY 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            +SGTRKE+LL    +LQK+++LR+I+  M   DA+EF+++KL  TK N +FF  M +
Sbjct: 361 NRSGTRKEELLTTPDELQKIWILRKIIHPMGEIDAMEFMMNKLSMTKTNDEFFDMMKR 418


>gi|218783035|ref|YP_002434353.1| transcription termination factor Rho [Desulfatibacillum
           alkenivorans AK-01]
 gi|218764419|gb|ACL06885.1| transcription termination factor Rho [Desulfatibacillum
           alkenivorans AK-01]
          Length = 422

 Score =  565 bits (1455), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 278/420 (66%), Positives = 341/420 (81%), Gaps = 3/420 (0%)

Query: 1   MSEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEV 60
            + M L  LK+K   +L A  +S  IE A  MRKQEL+F+IL+  + ++  I GEG +E+
Sbjct: 5   FAPMNLGALKDKKINELAAIGKSFNIEGAAGMRKQELIFAILRAQTEKNGMIHGEGTLEI 64

Query: 61  LQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVN 120
           L DGFGFLR+PD NYL GPDDIYVSPSQI+ F+L+TGDTV G IR P+E ERYFALLKV 
Sbjct: 65  LPDGFGFLRAPDYNYLPGPDDIYVSPSQIRRFNLRTGDTVAGQIRQPKESERYFALLKVE 124

Query: 121 AINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIV 180
           ++NF+ PE  R+KI FDNLTPLYP+ R NME    E  + S R+I+L+ PIG GQR LIV
Sbjct: 125 SVNFEDPEVSRDKILFDNLTPLYPNDRMNMER---EADNYSVRIINLLTPIGFGQRGLIV 181

Query: 181 APPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAA 240
           +PPR+GKT+LLQNIA+SI  NH + +LIVLLIDERPEEVTDMQRSV+ EVISSTFDE A 
Sbjct: 182 SPPRSGKTMLLQNIANSINANHKDVFLIVLLIDERPEEVTDMQRSVKAEVISSTFDEPAQ 241

Query: 241 RHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRP 300
           RHVQVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++P SGKIL+GGVD+NAL RP
Sbjct: 242 RHVQVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVVPPSGKILSGGVDSNALHRP 301

Query: 301 KRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPA 360
           KRFFGAARN++EGGSLTII TAL+DTGSRMDEVIFEEFKGTGN E+ L+R++ADKR FPA
Sbjct: 302 KRFFGAARNVEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNLELQLDRRLADKRTFPA 361

Query: 361 MDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           +DI +SGTRKE+LL+  + L +V++LR+++SS+N  D++EFL++K+K T DN+DF  SMN
Sbjct: 362 IDINRSGTRKEELLLPPETLNRVWILRKLLSSLNPIDSMEFLLEKMKGTSDNEDFLQSMN 421


>gi|121998834|ref|YP_001003621.1| transcription termination factor Rho [Halorhodospira halophila SL1]
 gi|121590239|gb|ABM62819.1| transcription termination factor Rho [Halorhodospira halophila SL1]
          Length = 419

 Score =  565 bits (1455), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 269/419 (64%), Positives = 342/419 (81%), Gaps = 1/419 (0%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK K  T+LL  A+S+ IE     RKQ+++F+ILK  +     I G+GV+E+LQD
Sbjct: 1   MNLTELKRKPATELLEIAQSMGIEGTARSRKQDIIFAILKAHAKNGDSIYGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS DA+Y+AGPDDIYVSPSQI+ F+L+TGDT+ G IR P++GERYFALLKV+ IN
Sbjct: 61  GFGFLRSADASYMAGPDDIYVSPSQIRRFALRTGDTITGKIRPPKDGERYFALLKVDQIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           F+ PE  +NK+ F+NLTPL+   R  ME  N   +D+++RVIDL+APIGKGQR LIV+PP
Sbjct: 121 FEPPEAAKNKVLFENLTPLFTRDRMRMERGNGSTEDLTARVIDLVAPIGKGQRGLIVSPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSV-QGEVISSTFDESAARH 242
           + GKT++LQN+A SI  N+PECYLIVLLIDERPEEVT+  RSV   E +SSTFDE A+RH
Sbjct: 181 KAGKTMMLQNVAQSITYNYPECYLIVLLIDERPEEVTEFARSVLSAETVSSTFDEPASRH 240

Query: 243 VQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKR 302
           VQVAEMVI KAK LVE+  DVVILLDS+TRL RAYN ++PSSGK+LTGGVDANAL RPKR
Sbjct: 241 VQVAEMVIEKAKRLVEHKKDVVILLDSVTRLARAYNTVVPSSGKVLTGGVDANALHRPKR 300

Query: 303 FFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMD 362
           FFGAARN++EGGSLTI+ TALV+TGSRMDEVI+EEFKGTGN E+ ++RKIA+KRI+PA+ 
Sbjct: 301 FFGAARNVEEGGSLTILATALVETGSRMDEVIYEEFKGTGNMELHMDRKIAEKRIYPAIH 360

Query: 363 IIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
           + +SGTR+E+LL+  ++LQK ++LR+++ +M+   AIEFL+DKLK TK N +FF +M +
Sbjct: 361 LNRSGTRREELLMTPEELQKTWILRKLLHNMDEVAAIEFLLDKLKDTKTNTEFFEAMKR 419


>gi|294142600|ref|YP_003558578.1| transcription termination factor Rho [Shewanella violacea DSS12]
 gi|293329069|dbj|BAJ03800.1| transcription termination factor Rho [Shewanella violacea DSS12]
          Length = 422

 Score =  565 bits (1455), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 273/416 (65%), Positives = 338/416 (81%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK KS + L+  A+ +++EN    RKQ+++FSILK  +    +I G GV+E+LQD
Sbjct: 1   MNLSELKEKSISDLVKLAQEMKVENTARARKQDIIFSILKAHAKSGEDIFGGGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS DA+YLAGPDDIYVSPSQI+ FS++TGDT+ G IR P+EGERYFALLKV+ +N
Sbjct: 61  GFGFLRSGDASYLAGPDDIYVSPSQIRRFSMRTGDTIFGKIRPPKEGERYFALLKVSEVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           FD PE  R KI F+NLTPL+ ++R  ME  N   +DI+SR++DL +PIGKGQR LIVAPP
Sbjct: 121 FDKPENSRTKILFENLTPLHAEERLRMERGNGSTEDITSRILDLCSPIGKGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQN+A SI  N+P+  L+VLLIDERPEEVT+MQR V+GEVI+STFDE A+RHV
Sbjct: 181 KAGKTLLLQNMAQSITHNNPDVVLMVLLIDERPEEVTEMQRMVKGEVIASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANAL RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVIPSSGKVLTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+ GGSLTII TALVDTGS+MDEVI+EEFKGTGN E+ L RK A+KR+FPA+D 
Sbjct: 301 FGAARNIEHGGSLTIIATALVDTGSKMDEVIYEEFKGTGNQELHLSRKAAEKRVFPAIDF 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSM 419
            +SGTR+E+ L    +LQK+++LR+I+  M+   A+EFLIDKL  TK N++FF +M
Sbjct: 361 NRSGTRREEKLTTPDELQKMWILRKILHPMDEVSAMEFLIDKLALTKTNEEFFNAM 416


>gi|149927012|ref|ZP_01915270.1| transcription termination factor Rho [Limnobacter sp. MED105]
 gi|149824233|gb|EDM83453.1| transcription termination factor Rho [Limnobacter sp. MED105]
          Length = 418

 Score =  564 bits (1454), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 269/418 (64%), Positives = 345/418 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK +  + LL  A  LEIENAN MRKQELMF+ILK  +    +I G+GV+EVL D
Sbjct: 1   MYLSELKTQHVSALLEVAGGLEIENANRMRKQELMFAILKKRAKNGEQIFGDGVLEVLPD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSP+ +YLA PDDIY+SPSQI+ F+L TGD++EG +R P++GERYFAL+KV+ +N
Sbjct: 61  GFGFLRSPETSYLASPDDIYISPSQIRRFNLHTGDSIEGEVRTPKDGERYFALVKVDKVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
            + PE  ++KI F+NLTPL+P++   +E +    ++ + R+IDL+APIGKGQR L+VAPP
Sbjct: 121 GEAPEASKHKILFENLTPLHPNQPLKLERDMRGEENNTGRIIDLVAPIGKGQRGLLVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           ++GKT++LQ+IAH+I  NHP+  LIVLLIDERPEEVT+M RSV+GEVI+STFDE A RHV
Sbjct: 181 KSGKTVMLQHIAHAITANHPDITLIVLLIDERPEEVTEMMRSVRGEVIASTFDEPATRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANAL RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKRDVVILLDSITRLARAYNTVVPSSGKVLTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TALVDTGSRMDEVI+EEFKGTGN EI +ER++A+KR++PA++I
Sbjct: 301 FGAARNIEEGGSLTIIATALVDTGSRMDEVIYEEFKGTGNMEIHMERRMAEKRVYPAINI 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            +S TR+E+LL++   LQK+++LRR++  M+   A+EFL+DK++QTK+N +FF  M K
Sbjct: 361 NRSSTRREELLIKPDLLQKIWVLRRLLHDMDEIAAMEFLMDKIRQTKNNAEFFEMMKK 418


>gi|319760698|ref|YP_004124636.1| transcription termination factor Rho [Candidatus Blochmannia vafer
           str. BVAF]
 gi|318039412|gb|ADV33962.1| transcription termination factor Rho [Candidatus Blochmannia vafer
           str. BVAF]
          Length = 419

 Score =  564 bits (1454), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 268/418 (64%), Positives = 339/418 (81%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L +LKN   ++L+   E + +EN   MRKQ+++F+I K  +    +I G+GV+E+LQD
Sbjct: 1   MNLTKLKNIPVSELVKLGEGMGLENLARMRKQDIIFAIFKQHAKTGEDIFGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P+EGERYFALLKVN +N
Sbjct: 61  GFGFLRSSDSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNDVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           +D PE  R+KI F+NLTPL+ + R  ME  N   +D+++RV+DL +PIG+GQR LIVAPP
Sbjct: 121 YDKPENARSKILFENLTPLHANSRLRMERGNGSTEDLTARVLDLASPIGRGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA SI  N+P+C LIVLLIDERPEEVT+MQR V GEVI+STFDE A+RHV
Sbjct: 181 KAGKTMLLQNIAQSISHNYPDCVLIVLLIDERPEEVTEMQRLVHGEVIASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DV+ILLDSITRL RAYN ++P+SGK+LTGGVDANAL RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHRKDVIILLDSITRLARAYNTIVPASGKVLTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TAL+DTGS+MDEVI+EEFKGTGN E+ L RKIA+KR+FPA+D 
Sbjct: 301 FGAARNMEEGGSLTIIATALIDTGSKMDEVIYEEFKGTGNMELHLSRKIAEKRVFPAIDY 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            +SGTRKE+LL    +LQK+++LR+I+  M   DA+EF+++KL  TK N +FF  M +
Sbjct: 361 NRSGTRKEELLTTHDELQKIWILRKIIHPMGEIDAMEFMMNKLSMTKTNDEFFDMMKR 418


>gi|94499750|ref|ZP_01306286.1| transcription termination factor Rho [Oceanobacter sp. RED65]
 gi|94427951|gb|EAT12925.1| transcription termination factor Rho [Oceanobacter sp. RED65]
          Length = 418

 Score =  564 bits (1454), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 268/416 (64%), Positives = 347/416 (83%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK KS  +LL  AES+ +EN +  RKQ+L+FSILK  +    +I G+GV+E+LQD
Sbjct: 1   MNLTELKKKSVAQLLEIAESMGMENVSRARKQDLIFSILKRHAKSGEDIYGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+++ GD + G IR P++ ERYFALLKVN +N
Sbjct: 61  GFGFLRSADSSYLAGPDDIYVSPSQIRRFNMRKGDFIAGKIRPPKDSERYFALLKVNEVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
            + PE+ +NKI F+NLTPL+P +R+ +E  N   +DISSR+IDLIAPIGKGQR LIVAPP
Sbjct: 121 GEAPEKSKNKILFENLTPLFPTERYILEQGNGSTEDISSRIIDLIAPIGKGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQ IA SI +N+PE +LIVLLIDERPEEVT+M R+V+GEV++STFDE  ARHV
Sbjct: 181 KAGKTMLLQTIAGSIARNNPESHLIVLLIDERPEEVTEMARNVRGEVVASTFDEPPARHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK +VE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDA+AL++PKRF
Sbjct: 241 QVAEMVIEKAKRMVEHKQDVVILLDSITRLARAYNTVIPSSGKVLTGGVDAHALEKPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSL+II TALVDTGS+MDEVI+EEFKGTGN E+ L+RK ++KRI+PA++I
Sbjct: 301 FGAARNVEEGGSLSIIATALVDTGSKMDEVIYEEFKGTGNMELHLDRKASEKRIYPAINI 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSM 419
            +SGTR+ED ++   +LQ++++LR+I++ M    AIEF++D+LKQTK N++FF +M
Sbjct: 361 RRSGTRREDQMMPEGELQRLWILRKIIAEMEDLQAIEFMVDRLKQTKTNEEFFLTM 416


>gi|170724878|ref|YP_001758904.1| transcription termination factor Rho [Shewanella woodyi ATCC 51908]
 gi|169810225|gb|ACA84809.1| transcription termination factor Rho [Shewanella woodyi ATCC 51908]
          Length = 421

 Score =  564 bits (1454), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 272/418 (65%), Positives = 340/418 (81%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK+KS + L+  A+ +++EN    RKQ+++FSILK  +    +I G GV+E+LQD
Sbjct: 1   MNLSELKDKSISDLVLLAQEMKVENTARARKQDIIFSILKAHAKSGEDIFGGGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS DA+YLAGPDDIYVSPSQI+ FS++TGDT+ G IR P+EGERYFALLKV+ +N
Sbjct: 61  GFGFLRSADASYLAGPDDIYVSPSQIRRFSMRTGDTIFGKIRPPKEGERYFALLKVSEVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           FD PE  R+KI F+NLTPL+ ++R  ME  N   +DI+SR++DL +PIGKGQR LIVAPP
Sbjct: 121 FDKPENSRSKILFENLTPLHAEERIRMERGNGSTEDITSRILDLCSPIGKGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQN+A SI  N+P+  L+VLLIDERPEEVT+MQR V+GEVI+STFDE A+RHV
Sbjct: 181 KAGKTLLLQNMAQSITYNNPDVVLMVLLIDERPEEVTEMQRMVKGEVIASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANAL RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVIPSSGKVLTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+ GGSLTII TALVDTGS+MDEVI+EEFKGTGN E+ L RK A+KR+FPA+D 
Sbjct: 301 FGAARNIEHGGSLTIIATALVDTGSKMDEVIYEEFKGTGNQELHLSRKAAEKRVFPAIDF 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            +SGTR+E+ L    +LQK+++LR+I++ M+    +EFLIDKL  TK N +FF +M +
Sbjct: 361 NRSGTRREEKLTTPDELQKMWILRKILNPMDEVTGMEFLIDKLAMTKTNDEFFTAMKR 418


>gi|312796072|ref|YP_004028994.1| transcription termination factor rho [Burkholderia rhizoxinica HKI
           454]
 gi|312167847|emb|CBW74850.1| Transcription termination factor rho [Burkholderia rhizoxinica HKI
           454]
          Length = 420

 Score =  563 bits (1452), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 266/418 (63%), Positives = 347/418 (83%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK++  + L+  A  LEIENAN +RKQELMF+ILK  +     I G+G +EVL D
Sbjct: 1   MHLSELKSQHVSALIEMANGLEIENANRLRKQELMFAILKKRAKTGETIFGDGTLEVLPD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSP+ +YLA  DDIY+SPSQI+ F+L TGDT+EG +R P++GERYFAL+KV+ +N
Sbjct: 61  GFGFLRSPETSYLASTDDIYISPSQIRRFNLHTGDTIEGEVRTPKDGERYFALVKVDKVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
              PE  ++KI F+NLTPL+P+K  ++E +    ++I+SR+ID+IAPIGKGQR L+VA P
Sbjct: 121 GQPPEASKHKIMFENLTPLHPNKPLSLERDVRGEENITSRIIDMIAPIGKGQRGLLVASP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           ++GKT++LQ+IAH+IK NHP+  L VLLIDERPEEVT+MQRSV GEVI+STFDE A+RHV
Sbjct: 181 KSGKTVMLQHIAHAIKSNHPDVTLFVLLIDERPEEVTEMQRSVAGEVIASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE   DVVILLDSITRL RAYN ++P+SGK+LTGGVDANALQRPKRF
Sbjct: 241 QVAEMVIEKAKRLVEMKHDVVILLDSITRLARAYNTVVPASGKVLTGGVDANALQRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTIIGTAL++TGSRMD+VI+EEFKGTGN E+ LER++A+KR++P++++
Sbjct: 301 FGAARNVEEGGSLTIIGTALIETGSRMDDVIYEEFKGTGNMEVHLERRLAEKRVYPSINL 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            KSGTR+E+LL++ + LQK+++LR+ +  M+  +A+EFL+DKLKQTK N +FF  M +
Sbjct: 361 NKSGTRREELLIKPEILQKIWVLRKFIHDMDEIEAMEFLLDKLKQTKSNSEFFDMMRR 418


>gi|123440565|ref|YP_001004559.1| transcription termination factor Rho [Yersinia enterocolitica
           subsp. enterocolitica 8081]
 gi|238750655|ref|ZP_04612154.1| Transcription termination factor rho [Yersinia rohdei ATCC 43380]
 gi|238759814|ref|ZP_04620971.1| Transcription termination factor rho [Yersinia aldovae ATCC 35236]
 gi|238784755|ref|ZP_04628758.1| Transcription termination factor rho [Yersinia bercovieri ATCC
           43970]
 gi|238789358|ref|ZP_04633144.1| Transcription termination factor rho [Yersinia frederiksenii ATCC
           33641]
 gi|238794284|ref|ZP_04637897.1| Transcription termination factor rho [Yersinia intermedia ATCC
           29909]
 gi|238798895|ref|ZP_04642361.1| Transcription termination factor rho [Yersinia mollaretii ATCC
           43969]
 gi|332159795|ref|YP_004296372.1| transcription termination factor Rho [Yersinia enterocolitica
           subsp. palearctica 105.5R(r)]
 gi|122087526|emb|CAL10307.1| transcription termination factor [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|238701957|gb|EEP94517.1| Transcription termination factor rho [Yersinia aldovae ATCC 35236]
 gi|238711045|gb|EEQ03264.1| Transcription termination factor rho [Yersinia rohdei ATCC 43380]
 gi|238714351|gb|EEQ06360.1| Transcription termination factor rho [Yersinia bercovieri ATCC
           43970]
 gi|238717249|gb|EEQ09099.1| Transcription termination factor rho [Yersinia mollaretii ATCC
           43969]
 gi|238722501|gb|EEQ14155.1| Transcription termination factor rho [Yersinia frederiksenii ATCC
           33641]
 gi|238726368|gb|EEQ17909.1| Transcription termination factor rho [Yersinia intermedia ATCC
           29909]
 gi|318607666|emb|CBY29164.1| transcription termination factor Rho [Yersinia enterocolitica
           subsp. palearctica Y11]
 gi|325664025|gb|ADZ40669.1| transcription termination factor Rho [Yersinia enterocolitica
           subsp. palearctica 105.5R(r)]
 gi|330859825|emb|CBX70157.1| transcription termination factor rho [Yersinia enterocolitica
           W22703]
          Length = 419

 Score =  563 bits (1451), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 276/418 (66%), Positives = 340/418 (81%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELKN   + L+   E++ +EN   MRKQ+++FSILK  +    +I G+GV+E+LQD
Sbjct: 1   MNLTELKNTPVSDLITLGENMGLENLARMRKQDIIFSILKQHAKSGEDIFGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGDTV G IR P+EGERYFALLKVN +N
Sbjct: 61  GFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTVAGKIRPPKEGERYFALLKVNEVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           +D PE  RNKI F+NLTPL+ + R  ME  N   +D+++RV+DL +PIG+GQR LIVAPP
Sbjct: 121 YDKPENARNKILFENLTPLHANSRLRMERGNGSTEDLTARVLDLASPIGRGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA SI  NHP+C L+VLLIDERPEEVT+MQR V+GEVI+STFDE A+RHV
Sbjct: 181 KAGKTMLLQNIATSIAYNHPDCVLMVLLIDERPEEVTEMQRLVKGEVIASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DV+ILLDSITRL RAYN ++P+SGK+LTGGVDANAL RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVIILLDSITRLARAYNTVVPASGKVLTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TALVDTGS+MDEVI+EEFKGTGN E+ L RKIA+KR+FPA+D 
Sbjct: 301 FGAARNVEEGGSLTIIATALVDTGSKMDEVIYEEFKGTGNMELHLSRKIAEKRVFPAIDF 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            +SGTRKE+LL   ++LQK+++LRRI+  M   DA+EFLI KL   K N  FF +M +
Sbjct: 361 NRSGTRKEELLTTTEELQKMWILRRILHPMGEIDAMEFLISKLATAKTNDQFFDNMRR 418


>gi|91791811|ref|YP_561462.1| transcription termination factor Rho [Shewanella denitrificans
           OS217]
 gi|91713813|gb|ABE53739.1| transcription termination factor Rho [Shewanella denitrificans
           OS217]
          Length = 421

 Score =  563 bits (1450), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 270/418 (64%), Positives = 340/418 (81%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK+   + L++ AE++++EN    RKQ+++FSILK  +    +I G GV+E+LQD
Sbjct: 1   MNLTELKDTPISDLVSLAETMKLENMARTRKQDIIFSILKAHAKSGEDIFGGGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D +YLAGPDDIYVSPSQI+ F+++TGD++ G IR P+EGERYFALLKV+ +N
Sbjct: 61  GFGFLRSSDGSYLAGPDDIYVSPSQIRRFNMRTGDSIFGKIRPPKEGERYFALLKVSEVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           FD PE  +NKI F+NLTPL+ ++R  ME  N   +DI++R++DL +PIGKGQR LIVAPP
Sbjct: 121 FDKPESSKNKILFENLTPLHAEERLRMERGNGSTEDITARILDLCSPIGKGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA SI  N+P+  LIVLLIDERPEEVT+MQR V+GEVI+STFDE A+RHV
Sbjct: 181 KAGKTLLLQNIAQSITYNNPDVVLIVLLIDERPEEVTEMQRLVKGEVIASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANAL RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVIPSSGKVLTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+ GGSLTII TALVDTGS+MDEVI+EEFKGTGN E+ L RK A+KR+FPA+D 
Sbjct: 301 FGAARNIEHGGSLTIIATALVDTGSKMDEVIYEEFKGTGNQELHLSRKAAEKRVFPAIDF 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            +SGTR+E+ L   ++LQK+++LR+I+  M+   A+EFLIDKL  TK N +FF +M +
Sbjct: 361 NRSGTRREEKLTTTEELQKMWILRKILHPMDEVAAMEFLIDKLAMTKTNDEFFTAMKR 418


>gi|27905006|ref|NP_778132.1| transcription termination factor Rho [Buchnera aphidicola str. Bp
           (Baizongia pistaciae)]
 gi|32699635|sp|Q89A22|RHO_BUCBP RecName: Full=Transcription termination factor Rho; AltName:
           Full=ATP-dependent helicase Rho
 gi|27904404|gb|AAO27237.1| rranscription termination factor rho [Buchnera aphidicola str. Bp
           (Baizongia pistaciae)]
          Length = 419

 Score =  563 bits (1450), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 267/418 (63%), Positives = 342/418 (81%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L  LKN   ++L+   ++  +EN   MRKQ+++FSILK  +    +I G+GV+E+LQD
Sbjct: 1   MNLTALKNIPVSELIFLGDNAGLENLARMRKQDIIFSILKQHAKSGEDIFGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P+EGERYFALLKVN +N
Sbjct: 61  GFGFLRSSDSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNKVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           +D PE  R+KI F+NLTPL+ + R  ME  N   +D+++RV+DL +PIG+GQR LIVAPP
Sbjct: 121 YDKPENARSKILFENLTPLHANSRLRMERGNGSTEDLTARVLDLASPIGRGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA SI  NHP+C L+VLLIDERPEEVT+M+R V+GEV++STFDE ++RHV
Sbjct: 181 KAGKTMLLQNIAQSIAYNHPDCVLMVLLIDERPEEVTEMRRLVKGEVVASTFDEPSSRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QV+EMVI KAK LVE+  DV+ILLDSITRL RAYN ++P+SGK+LTGGVDANAL RPKRF
Sbjct: 241 QVSEMVIEKAKRLVEHKKDVIILLDSITRLARAYNTVVPASGKVLTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TAL+DTGS+MDEVI+EEFKGTGN E+ L RKIA+KR+FPA+D 
Sbjct: 301 FGAARNVEEGGSLTIIATALIDTGSKMDEVIYEEFKGTGNMELPLSRKIAEKRVFPAIDY 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            +SGTRKE+LL +  +LQK+++LR+I+  M+  DA+EFLI+KL  TK N +FF  M +
Sbjct: 361 NRSGTRKEELLTKSDELQKMWILRKIIHPMSEIDAMEFLINKLAMTKTNNEFFDMMKR 418


>gi|261492345|ref|ZP_05988907.1| transcription termination factor Rho [Mannheimia haemolytica
           serotype A2 str. BOVINE]
 gi|261496131|ref|ZP_05992539.1| transcription termination factor Rho [Mannheimia haemolytica
           serotype A2 str. OVINE]
 gi|261308233|gb|EEY09528.1| transcription termination factor Rho [Mannheimia haemolytica
           serotype A2 str. OVINE]
 gi|261312028|gb|EEY13169.1| transcription termination factor Rho [Mannheimia haemolytica
           serotype A2 str. BOVINE]
          Length = 420

 Score =  563 bits (1450), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 272/419 (64%), Positives = 341/419 (81%), Gaps = 1/419 (0%)

Query: 4   MKLQELKNKSPTKLLAFAES-LEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQ 62
           M L +LKN   ++L+   E+ + +EN   +RKQ+++F+ILK  +    +I G+GV+E+L 
Sbjct: 1   MHLTQLKNTPVSELVEMGENQMGLENLARLRKQDIVFAILKQHAKSGEDIFGQGVLEILP 60

Query: 63  DGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAI 122
           DGFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGD +EG IR P+EGERYFALLKV+++
Sbjct: 61  DGFGFLRSSDSSYLAGPDDIYVSPSQIRRFNLQTGDKIEGKIRPPKEGERYFALLKVDSV 120

Query: 123 NFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAP 182
           N D PE  R+KI F+NLTPL+ + R  ME  N   +D+++R++DL APIGKGQR+LIVAP
Sbjct: 121 NDDKPEASRSKILFENLTPLHANSRLKMERGNGSKEDLTARILDLAAPIGKGQRALIVAP 180

Query: 183 PRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARH 242
           P+ GKT+LLQNIA SI  NHPEC LIVLLIDERPEEVT+MQR+V+GEVI+STFDE A RH
Sbjct: 181 PKAGKTVLLQNIAQSITHNHPECELIVLLIDERPEEVTEMQRTVRGEVIASTFDEPATRH 240

Query: 243 VQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKR 302
           VQVAEMVI KAK  VE+  DVVILLDSITRL RAYN + P SGKIL+GGVDANAL RPKR
Sbjct: 241 VQVAEMVIEKAKRSVEHKKDVVILLDSITRLARAYNTITPVSGKILSGGVDANALHRPKR 300

Query: 303 FFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMD 362
           FFGAARN++EGGSLTII TALVDTGS+MDEVIFEEFKGTGN E+ L R+IA++RIFPA+D
Sbjct: 301 FFGAARNVEEGGSLTIIATALVDTGSKMDEVIFEEFKGTGNMELHLSRRIAERRIFPAID 360

Query: 363 IIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
             +SGTRK+DLL+   +LQK +MLR++++ M+  DAIE+LIDKL   K N++FF  M +
Sbjct: 361 FNRSGTRKDDLLMAADELQKTWMLRKVLNPMDEVDAIEWLIDKLMMAKTNEEFFEIMKR 419


>gi|167625799|ref|YP_001676093.1| transcription termination factor Rho [Shewanella halifaxensis
           HAW-EB4]
 gi|167355821|gb|ABZ78434.1| transcription termination factor Rho [Shewanella halifaxensis
           HAW-EB4]
          Length = 421

 Score =  562 bits (1449), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 271/418 (64%), Positives = 337/418 (80%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK+ S + L+  A+ +++EN    RKQ+++FSILK  +    +I G GV+E+LQD
Sbjct: 1   MNLSELKDTSISDLVQLAQDMKLENMARARKQDIIFSILKAHAKSGEDIFGGGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D +YLAGPDDIYVSPSQI+ F+++TGDT+ G IR P+EGERYFALLKV  +N
Sbjct: 61  GFGFLRSSDGSYLAGPDDIYVSPSQIRRFNMRTGDTIFGKIRPPKEGERYFALLKVTEVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           FD PE  RNKI F+NLTPL+ ++R  ME  N   +DI+SR++DL +PIGKGQR LIVAPP
Sbjct: 121 FDKPENSRNKILFENLTPLHAEERMRMERGNGSTEDITSRILDLCSPIGKGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQN+A SI  N+PE  L+VLLIDERPEEVT+MQR V+GEVI+STFDE A+RHV
Sbjct: 181 KAGKTLLLQNMAQSITNNNPEVVLMVLLIDERPEEVTEMQRMVKGEVIASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANAL RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVIPSSGKVLTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+ GGSLTII TALVDTGS+MDEVI+EEFKGTGN E+ L RK A+KR+FPA+D 
Sbjct: 301 FGAARNIEHGGSLTIIATALVDTGSKMDEVIYEEFKGTGNQELHLSRKAAEKRVFPAIDF 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            +SGTR+E+ L    +LQK+++LR+I++ M+    +EFLIDKL  TK N +FF +M +
Sbjct: 361 NRSGTRREEKLTTPDELQKMWILRKILNPMDEVTGMEFLIDKLAMTKTNDEFFTAMKR 418


>gi|296136200|ref|YP_003643442.1| transcription termination factor Rho [Thiomonas intermedia K12]
 gi|294340435|emb|CAZ88816.1| Transcription termination factor rho (ATP-dependent helicase rho)
           [Thiomonas sp. 3As]
 gi|295796322|gb|ADG31112.1| transcription termination factor Rho [Thiomonas intermedia K12]
          Length = 420

 Score =  562 bits (1449), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 269/418 (64%), Positives = 345/418 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK    +KLL  A+S EIENA+ +RKQELMF+ILK  +    ++ G+G +EVL D
Sbjct: 1   MHLSELKATHVSKLLEMAQSFEIENASRLRKQELMFAILKKHARTGEQVFGDGCLEVLPD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLR+P+++Y+A PDDIY+SPSQI+ F+L TGD++EG +R P++GERYFAL+KV+ +N
Sbjct: 61  GFGFLRAPESSYMASPDDIYISPSQIRRFNLHTGDSIEGEVRVPKDGERYFALVKVDRVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
              PE  +NKI F+NLTPL+P +   +E +    ++I  RVID++APIGKGQR L+VAPP
Sbjct: 121 GVTPEENKNKIMFENLTPLFPTEHMRLERDIKGEENIIGRVIDIVAPIGKGQRGLLVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           ++GKT++LQ +AH+I  NHPE  LIVLLIDERPEEVT+MQRSV+GEV+SSTFDE A RHV
Sbjct: 181 KSGKTVMLQALAHAITNNHPEVVLIVLLIDERPEEVTEMQRSVRGEVVSSTFDEPAVRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE   DVVILLDSITRL RAYN ++P+SGKILTGGVDANALQRPKRF
Sbjct: 241 QVAEMVIEKAKRLVELKKDVVILLDSITRLARAYNTVIPTSGKILTGGVDANALQRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTIIGTALVDTGSRMDEVI+EEFKGTGN EI L+R++++KR++PAM I
Sbjct: 301 FGAARNIEEGGSLTIIGTALVDTGSRMDEVIYEEFKGTGNMEIHLDRRLSEKRVYPAMLI 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            +SGTR+E+LL++ + LQK ++LR+++  M+   A+EFL+DK+KQTK+N +FF  M +
Sbjct: 361 NRSGTRREELLLKPEILQKAWILRKLLYPMDEIQAMEFLLDKMKQTKNNAEFFDLMRR 418


>gi|83643188|ref|YP_431623.1| transcription termination factor Rho [Hahella chejuensis KCTC 2396]
 gi|83631231|gb|ABC27198.1| transcription termination factor Rho [Hahella chejuensis KCTC 2396]
          Length = 420

 Score =  562 bits (1449), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 272/420 (64%), Positives = 351/420 (83%), Gaps = 1/420 (0%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK K   +LL  AE + +EN    RKQ+++FSILK  +    +I G+GV+E+LQD
Sbjct: 1   MNLTELKKKPVPELLTIAEEMGLENMARSRKQDVIFSILKKHAKSGEDIYGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P++GERYFALLKVN IN
Sbjct: 61  GFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTIAGKIRPPKDGERYFALLKVNEIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           FD PE  RNKI F+NLTPL+P +R  +E  N   +D+S+R++DL+APIGKGQR LIV+PP
Sbjct: 121 FDKPENARNKILFENLTPLFPQERLRLEAGNGSTEDLSARILDLVAPIGKGQRGLIVSPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+L+QNIA SI +N+PE +L+VLLIDERPEEVT+MQR+V+GEV++STFDE  ARHV
Sbjct: 181 KAGKTLLMQNIAQSITRNNPETHLMVLLIDERPEEVTEMQRTVRGEVVASTFDEPPARHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDA+AL+RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTIIPSSGKVLTGGVDAHALERPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTI+ TAL+DTGS+MDEVI+EEFKGTGN E+ L+R+I++KR+FPA++I
Sbjct: 301 FGAARNVEEGGSLTIVATALIDTGSKMDEVIYEEFKGTGNLEVHLDRRISEKRVFPAINI 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSS-DAIEFLIDKLKQTKDNKDFFYSMNKQ 422
            +SGTR+E+LL+  ++LQ+V++LR+++ SM     A+EFL+DKLK TK N +FF +M K+
Sbjct: 361 RRSGTRREELLMSEEELQRVWILRKLLHSMEDDIAAVEFLLDKLKDTKTNDEFFQAMKKR 420


>gi|146305350|ref|YP_001185815.1| transcription termination factor Rho [Pseudomonas mendocina ymp]
 gi|145573551|gb|ABP83083.1| transcription termination factor Rho [Pseudomonas mendocina ymp]
          Length = 419

 Score =  562 bits (1449), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 274/419 (65%), Positives = 348/419 (83%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK K   +LL  AE + +EN    RKQ+++F++LK  +    EI G+GV+E+LQD
Sbjct: 1   MNLTELKQKPIAELLDMAEQMGLENMARSRKQDIIFALLKKHAKSGEEISGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P+EGERYFALLKV++IN
Sbjct: 61  GFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTIVGKIRPPKEGERYFALLKVDSIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           FD PE  +NKI F+NLTPL+P+KR  ME  N   +DI+ RVIDL APIGKGQR LIVAPP
Sbjct: 121 FDRPENAKNKILFENLTPLFPNKRLTMEAGNGSTEDITGRVIDLCAPIGKGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKTI+LQNIA +I +N+PE +LIVLLIDERPEEVT+MQR+V+GEV++STFDE   RHV
Sbjct: 181 KAGKTIMLQNIASNITRNNPEVHLIVLLIDERPEEVTEMQRTVRGEVVASTFDEPPTRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDA+AL++PKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVIPSSGKVLTGGVDAHALEKPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTI+ TAL++TGS+MDEVI+EEFKGTGN E++L+R++A+KR FPA++I
Sbjct: 301 FGAARNIEEGGSLTILATALIETGSKMDEVIYEEFKGTGNMELILDRRVAEKRTFPAINI 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQ 422
            KSGTR+E+LL   ++L ++++LR+++  M+   AIEFLIDKLK TK N +FF SM ++
Sbjct: 361 NKSGTRREELLTGEEELSRMWILRKLLHPMDEIAAIEFLIDKLKATKTNDEFFLSMKRK 419


>gi|163748718|ref|ZP_02155971.1| transcription termination factor Rho [Shewanella benthica KT99]
 gi|161331828|gb|EDQ02632.1| transcription termination factor Rho [Shewanella benthica KT99]
          Length = 422

 Score =  562 bits (1449), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 270/416 (64%), Positives = 338/416 (81%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK+ S + L+  A+ +++EN    RKQ+++FSILK  +    +I G GV+E+LQD
Sbjct: 1   MNLSELKDTSISDLVKLAQEMKVENTARARKQDIIFSILKAHAKSGEDIFGGGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS DA+YLAGPDDIYVSPSQI+ FS++TGDT+ G IR P+EGERYFALLKV+ +N
Sbjct: 61  GFGFLRSGDASYLAGPDDIYVSPSQIRRFSMRTGDTIFGKIRPPKEGERYFALLKVSEVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           +D PE  RNKI F+NLTPL+ ++R  ME  N   +DI+SR++DL +PIGKGQR LIVAPP
Sbjct: 121 YDKPENSRNKILFENLTPLHAEERLRMERGNGSTEDITSRILDLCSPIGKGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQN+A SI  N+P+  L+VLLIDERPEEVT+MQR V+GEVI+STFDE A+RHV
Sbjct: 181 KAGKTLLLQNMAQSITHNNPDVVLMVLLIDERPEEVTEMQRMVKGEVIASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGG+DANAL RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVIPSSGKVLTGGIDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+ GGSLTII TALVDTGS+MDEVI+EEFKGTGN E+ L RK A+KR+FPA+D 
Sbjct: 301 FGAARNIEHGGSLTIIATALVDTGSKMDEVIYEEFKGTGNQELHLSRKAAEKRVFPAIDF 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSM 419
            +SGTR+E+ L    +LQK+++LR+I+  M+    +EFLIDKL  TK N++FF +M
Sbjct: 361 NRSGTRREEKLTTPDELQKMWILRKILHPMDEVSGMEFLIDKLALTKTNEEFFNAM 416


>gi|332289422|ref|YP_004420274.1| transcription termination factor Rho [Gallibacterium anatis UMN179]
 gi|330432318|gb|AEC17377.1| transcription termination factor Rho [Gallibacterium anatis UMN179]
          Length = 420

 Score =  562 bits (1449), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 274/419 (65%), Positives = 339/419 (80%), Gaps = 1/419 (0%)

Query: 4   MKLQELKNKSPTKLLAFAE-SLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQ 62
           M L ELKN   ++L+   E  + +EN   +RKQ+++F+ILK  S    +I G+GV+E+L 
Sbjct: 1   MNLTELKNMPVSELVKLGEEQMGLENLARLRKQDIIFAILKQHSKSGEDIFGDGVLEILP 60

Query: 63  DGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAI 122
           DGFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGD +EG IR P+EGERYFALLKVN +
Sbjct: 61  DGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDMIEGKIRPPKEGERYFALLKVNQV 120

Query: 123 NFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAP 182
           N D PE  RNKI F+NLTPL+ + R  ME  N   +D+++R++DL APIGKGQR+LIVAP
Sbjct: 121 NDDRPEISRNKILFENLTPLHANYRLRMERGNGSTEDLTARILDLAAPIGKGQRALIVAP 180

Query: 183 PRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARH 242
           P+ GKT+ LQNIA SI  N+PEC L+VLLIDERPEEVT+MQR V+GEV++STFDE AARH
Sbjct: 181 PKAGKTMFLQNIAQSITYNYPECILMVLLIDERPEEVTEMQRLVKGEVVASTFDEPAARH 240

Query: 243 VQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKR 302
           VQVAEMVI KAK LVE+  DVVILLDSITRL RAYN + P+SGK+L+GGVDANAL RPKR
Sbjct: 241 VQVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVTPASGKVLSGGVDANALHRPKR 300

Query: 303 FFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMD 362
           FFGAARN++EGGSLTII TALVDTGS+MDEVI+EEFKGTGN E+ L RKIA+KR+FPA+D
Sbjct: 301 FFGAARNVEEGGSLTIIATALVDTGSKMDEVIYEEFKGTGNMELHLSRKIAEKRVFPAID 360

Query: 363 IIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
              SGTRKE+LL    +LQK+++LR+IV  M   +A+EFLIDKL  TK N++FF +M +
Sbjct: 361 FNSSGTRKEELLTTPDELQKMWILRKIVHPMGEIEAMEFLIDKLSMTKTNEEFFEAMKR 419


>gi|307825388|ref|ZP_07655607.1| transcription termination factor Rho [Methylobacter tundripaludum
           SV96]
 gi|307733563|gb|EFO04421.1| transcription termination factor Rho [Methylobacter tundripaludum
           SV96]
          Length = 418

 Score =  562 bits (1448), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 274/418 (65%), Positives = 343/418 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK K  ++++  AESL +EN    RKQ+L+F+ILK  +    +I G+GV+E+LQD
Sbjct: 1   MNLTELKLKQISEVIEIAESLGLENVARSRKQDLIFAILKKQAKAGDDISGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLR+P  +YLAGPDDIYVSPSQI+ FSLKTGDT+ G IR P++ ERYFA+LKV+ IN
Sbjct: 61  GFGFLRTPGCSYLAGPDDIYVSPSQIRRFSLKTGDTISGKIRPPKDNERYFAMLKVDQIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           F+ PE  +NKI F NLTPL+  +RF +E  N  ++D++ R+IDLIAPIGKGQR LIV+PP
Sbjct: 121 FEPPENTKNKITFSNLTPLFAKQRFVLEQGNGTSEDLTGRMIDLIAPIGKGQRGLIVSPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT++LQ++A +I + +PECYLIVLLIDERPEEVT+M+R V+GEVISSTFDE A RHV
Sbjct: 181 KAGKTMILQSLAQAIAEQNPECYLIVLLIDERPEEVTEMERCVRGEVISSTFDEPATRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KA+ LVE+  DVVILLDSITRL RAYN ++PSSGKILTGGVDANAL++PKRF
Sbjct: 241 QVAEMVIEKARRLVEHKHDVVILLDSITRLARAYNTVVPSSGKILTGGVDANALEKPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TALVDTGSRMDEVI+EEFKGTGN E+ L+RKIA+KRI+PA++I
Sbjct: 301 FGAARNIEEGGSLTIIATALVDTGSRMDEVIYEEFKGTGNMELHLDRKIAEKRIYPAINI 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            +SGTR+E+ LV+   LQK ++LR+I+  M+ + A EFLI KLK  K N +FF SM +
Sbjct: 361 NRSGTRREEYLVDPDTLQKTWILRKILQPMDETAASEFLIGKLKDFKTNAEFFDSMKR 418


>gi|15804373|ref|NP_290413.1| transcription termination factor Rho [Escherichia coli O157:H7
           EDL933]
 gi|25299646|pir||E86064 hypothetical protein rho [imported] - Escherichia coli  (strain
           O157:H7, substrain EDL933)
 gi|12518646|gb|AAG58977.1|AE005610_1 transcription termination factor Rho; polarity suppressor
           [Escherichia coli O157:H7 str. EDL933]
          Length = 419

 Score =  562 bits (1448), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 273/418 (65%), Positives = 343/418 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELKN   ++L+   E++ +EN   MRKQ+++F+ILK  +    +I G+GV+E+LQD
Sbjct: 1   MNLTELKNTPVSELITLGENMGLENLARMRKQDIIFAILKQHAKSGEDIFGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P+EGERYFALLKVN +N
Sbjct: 61  GFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNEVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           FD PE  RNKI F+NLTPL+ + R  ME  N   +D+++RV+DL +PIG+GQR LIVAPP
Sbjct: 121 FDKPENARNKILFENLTPLHANSRLRMERGNGSTEDLTARVLDLASPIGRGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA SI  NHP+C L+VLLIDERPEEVT+MQR V+GEV++STFDE A+RHV
Sbjct: 181 KAGKTMLLQNIAQSIAYNHPDCVLMVLLIDERPEEVTEMQRLVKGEVVASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DV+ILLDSITRL RAYN ++P+SGK+LTGGVDANAL RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVIILLDSITRLARAYNTVVPASGKVLTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TAL+DTGS+MDEVI+EEFKGTGN E+ L RKIA+ R+FPA+D 
Sbjct: 301 FGAARNVEEGGSLTIIATALIDTGSKMDEVIYEEFKGTGNMELHLSRKIAEXRVFPAIDY 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            +SGTRKE+LL  +++LQK+++LR+I+  M   DA+EFLI+KL  TK N DFF  M +
Sbjct: 361 NRSGTRKEELLTXQEELQKMWILRKIIHPMGEIDAMEFLINKLAMTKTNDDFFEMMKR 418


>gi|116749146|ref|YP_845833.1| transcription termination factor Rho [Syntrophobacter fumaroxidans
           MPOB]
 gi|116698210|gb|ABK17398.1| transcription termination factor Rho [Syntrophobacter fumaroxidans
           MPOB]
          Length = 437

 Score =  562 bits (1448), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 274/420 (65%), Positives = 345/420 (82%), Gaps = 3/420 (0%)

Query: 2   SEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVL 61
           +EM L ELK+K+  +L+  A++L IE A+ MRKQEL+F++L+  +     I GEGV+E+L
Sbjct: 21  NEMNLVELKSKNIRELMTIAKALNIEGASSMRKQELIFALLQAQAEMSGLIYGEGVLEIL 80

Query: 62  QDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNA 121
            DGFGFLRS + NYL GPDDIYVSPSQI+ F+L+TGD+V G IR P++ ERYFALLKV A
Sbjct: 81  PDGFGFLRSQNYNYLPGPDDIYVSPSQIRRFNLRTGDSVSGQIRPPKDNERYFALLKVEA 140

Query: 122 INFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVA 181
           +N++ P+  R+KI FDNLTPLYPD+R  +E       ++S+RV+DL+ PIG GQR LIVA
Sbjct: 141 VNYEDPDVARDKILFDNLTPLYPDRRVRLE---SIADNLSTRVMDLLTPIGFGQRGLIVA 197

Query: 182 PPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAAR 241
            PRTGKT+LLQNIA+++  NH E YLIVLLIDERPEEVTDMQR+V+ EV+SSTFDE   R
Sbjct: 198 QPRTGKTMLLQNIANAVTVNHKEAYLIVLLIDERPEEVTDMQRNVRAEVVSSTFDEPPQR 257

Query: 242 HVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPK 301
           HVQVAEMV  KAK LVE+  DVVILLDSITRL RAYN ++P SGKIL+GG+D+NAL RPK
Sbjct: 258 HVQVAEMVSEKAKRLVEHKRDVVILLDSITRLARAYNSVVPPSGKILSGGLDSNALHRPK 317

Query: 302 RFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAM 361
           RFFGAARN+++GGSLTII TAL+DTGSRMDEVIFEEFKGTGN EIVL+RK+AD+RIFPA+
Sbjct: 318 RFFGAARNVEQGGSLTIIATALIDTGSRMDEVIFEEFKGTGNMEIVLDRKLADRRIFPAI 377

Query: 362 DIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
           DI KSGTRKE+LL+   DL ++++LR+++S +N  DA+EFL+DK++ TK+N DF  SMN+
Sbjct: 378 DINKSGTRKEELLLPSDDLNRIWILRKLLSPLNPIDAMEFLLDKMQGTKNNADFLASMNR 437


>gi|289209629|ref|YP_003461695.1| transcription termination factor Rho [Thioalkalivibrio sp. K90mix]
 gi|288945260|gb|ADC72959.1| transcription termination factor Rho [Thioalkalivibrio sp. K90mix]
          Length = 419

 Score =  562 bits (1448), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 265/418 (63%), Positives = 337/418 (80%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK  S   L+AFAE   I+N +  RKQE++F++LK  +     I G+GV+E+L D
Sbjct: 1   MNLTELKRMSAADLVAFAEEKGIDNMSRARKQEIIFALLKAHAKSGEAIYGDGVLEILSD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++Y AGPDD+YVSPSQI+ F L+TGDT+ G IR P++ ERYFALLKV+ IN
Sbjct: 61  GFGFLRSADSSYQAGPDDVYVSPSQIRRFGLRTGDTIAGKIRPPKDNERYFALLKVSEIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           F+ PE  R+K+ F+NLTPL+P KR  ME  N   +DI++RVID++AP GKGQR LIV+PP
Sbjct: 121 FEPPENARHKVLFENLTPLHPSKRMRMERGNGSTEDITARVIDIVAPFGKGQRGLIVSPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT++LQNIA SI  N+PECYLIVLLIDERPEEVT+M R VQGEV+SSTFDE A RHV
Sbjct: 181 KAGKTLMLQNIAQSIATNYPECYLIVLLIDERPEEVTEMDRMVQGEVVSSTFDEPAQRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN + PSSGK+LTGGVDANAL RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKRDVVILLDSITRLARAYNTVAPSSGKVLTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTI+ TALV+TGS+MDEVI+EEFKGTGN E+ LER+IA+KRI+PA+++
Sbjct: 301 FGAARNVEEGGSLTILATALVETGSKMDEVIYEEFKGTGNMEVHLERRIAEKRIYPAINV 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            +SGTR+E+LL    +LQK+++LR+ +  M+  +A+EFL+ +++ +K N +FF  M +
Sbjct: 361 NRSGTRREELLTAPDELQKLWILRKFLHGMDDIEAMEFLLGRMQSSKTNSEFFDQMKR 418


>gi|90023296|ref|YP_529123.1| transcription termination factor Rho [Saccharophagus degradans
           2-40]
 gi|89952896|gb|ABD82911.1| transcription termination factor Rho [Saccharophagus degradans
           2-40]
          Length = 419

 Score =  562 bits (1448), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 265/419 (63%), Positives = 346/419 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L +LK+K   +L+  A+ + +E+    RKQ+++F+ILK  +    +I G+GV+E+LQD
Sbjct: 1   MNLTDLKSKPIEELIDLAKEMGMESLARSRKQDVIFNILKRHARSGEDIYGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS  A+YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P+EGERYFALLKVN IN
Sbjct: 61  GFGFLRSAGASYLAGPDDIYVSPSQIRRFNLRTGDTIAGKIRPPKEGERYFALLKVNEIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           FD PE  RNKI F+NLTPL+P +R  +E  N   +D++ R+IDL++PIGKGQR LIVAPP
Sbjct: 121 FDKPENSRNKILFENLTPLFPQERLELETGNGSTEDLTGRIIDLVSPIGKGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKTI++QNIA +I +N+PEC+LIVLLIDERPEEVT+MQRSV+GEV++STFDE  +RHV
Sbjct: 181 KAGKTIMMQNIAQAITRNNPECHLIVLLIDERPEEVTEMQRSVRGEVVASTFDEPPSRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI +AK LVE+  DV+ILLDSITRL RAYN ++PSSGK+LTGGVDA+AL+RPKRF
Sbjct: 241 QVAEMVIERAKRLVEHKKDVIILLDSITRLARAYNTVIPSSGKVLTGGVDAHALERPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSL+I+ TAL+DTGS+MDEVI+EEFKGTGN E+ L+RKIA++R++PA++I
Sbjct: 301 FGAARNIEEGGSLSIVATALIDTGSKMDEVIYEEFKGTGNMELHLDRKIAERRVYPAINI 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQ 422
            +SGTR+EDLL++ ++L +V++LR+++  M    A EFL DKLK  K N +FF SM  +
Sbjct: 361 RRSGTRREDLLMKEEELSRVWILRKLLHDMEDVAATEFLSDKLKDFKTNNEFFLSMRSK 419


>gi|238755775|ref|ZP_04617107.1| Transcription termination factor rho [Yersinia ruckeri ATCC 29473]
 gi|238706002|gb|EEP98387.1| Transcription termination factor rho [Yersinia ruckeri ATCC 29473]
          Length = 419

 Score =  561 bits (1447), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 274/418 (65%), Positives = 342/418 (81%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELKN   + L+   E++ +EN   +RKQ+++FSILK  +    +I G+GV+E+LQD
Sbjct: 1   MNLTELKNTPVSDLITLGENMGLENLARLRKQDIIFSILKQHAKSGEDIFGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P+EGERYFALLKVN +N
Sbjct: 61  GFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNEVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           +D PE  RNKI F+NLTPL+ + R  ME  N   +D+++RV+DL +PIG+GQR LIVAPP
Sbjct: 121 YDKPENARNKILFENLTPLHANSRLRMERGNGSTEDLTARVLDLASPIGRGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA SI  NHP+C L+VLLIDERPEEVT+MQR V+GEVI+STFDE A+RHV
Sbjct: 181 KAGKTMLLQNIATSIAYNHPDCVLMVLLIDERPEEVTEMQRLVKGEVIASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DV+ILLDSITRL RAYN ++P+SGK+LTGGVDANAL RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVIILLDSITRLARAYNTVVPASGKVLTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TALVDTGS+MDEVI+EEFKGTGN E+ L RKIA+KR+FPA+D 
Sbjct: 301 FGAARNVEEGGSLTIIATALVDTGSKMDEVIYEEFKGTGNMELHLARKIAEKRVFPAIDY 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            +SGTRKE+LL   ++LQK+++LR+I+  M   DA+EFLI+KL  TK N +FF  M +
Sbjct: 361 NRSGTRKEELLTTTEELQKMWILRKIIHPMGEIDAMEFLINKLAMTKTNDEFFDMMRR 418


>gi|325982322|ref|YP_004294724.1| transcription termination factor Rho [Nitrosomonas sp. AL212]
 gi|325531841|gb|ADZ26562.1| transcription termination factor Rho [Nitrosomonas sp. AL212]
          Length = 419

 Score =  561 bits (1447), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 268/418 (64%), Positives = 349/418 (83%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M+L +LKN   T+L+  A   EI+ AN MRKQ+L+F++LK  + +   I G G +EVLQD
Sbjct: 1   MRLSDLKNLHVTELVKMAIENEIDGANRMRKQDLIFALLKNQARKGENIYGHGTLEVLQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSPD +YLAGPDDIY+SPSQI+ F+L TGD+++G IR P++GERYFAL+KV+ +N
Sbjct: 61  GFGFLRSPDTSYLAGPDDIYISPSQIRRFNLHTGDSIDGEIRPPKDGERYFALVKVDKVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
            + PE  + KI F+NLTPL+PD+R  +E +    ++I+SR+IDLIAPIGKGQR L+VA P
Sbjct: 121 NEPPENSKQKILFENLTPLFPDERLILERDIKAEENITSRIIDLIAPIGKGQRGLLVASP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           ++GKT++LQ+IAH+I  NHP+  L+VLLIDERPEEVT+M RSV+GEVISSTFDESAARHV
Sbjct: 181 KSGKTVMLQHIAHAIAANHPDVILMVLLIDERPEEVTEMIRSVKGEVISSTFDESAARHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++P+SGK+LTGGVDA+ALQRPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNAVVPASGKVLTGGVDASALQRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TAL+DTGSRMD+VI+EEFKGTGN EI L+R++A+KRI+PA+++
Sbjct: 301 FGAARNIEEGGSLTIIATALIDTGSRMDDVIYEEFKGTGNMEIHLDRRMAEKRIYPAINV 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            +S TR+E+LL+  + LQK+++LR+++  M+  DA+ FL+DK+K TK+N DFF SM +
Sbjct: 361 NRSSTRREELLIAAEVLQKIWVLRKLLHPMDDMDAMAFLLDKIKGTKNNSDFFDSMRR 418


>gi|307546375|ref|YP_003898854.1| transcription termination factor Rho [Halomonas elongata DSM 2581]
 gi|307218399|emb|CBV43669.1| transcription termination factor Rho [Halomonas elongata DSM 2581]
          Length = 419

 Score =  561 bits (1447), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 264/419 (63%), Positives = 345/419 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK K   +LL  A  + I+N    RKQ+++F+ILK  +     I G+GV+E+LQD
Sbjct: 1   MNLTELKQKPVPELLEIARDMGIDNLARSRKQDIIFAILKKHAKSGEAIYGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+ GD++ G IR P+EGERYFALLKV+ IN
Sbjct: 61  GFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRKGDSISGKIRPPKEGERYFALLKVSQIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           FD PE  ++KI F+NLTPL+P +R  ME+ N   +D+++R+IDL++PIGKGQR L+V+PP
Sbjct: 121 FDKPENAKHKILFENLTPLFPQERLRMEIGNGSTEDLTARIIDLVSPIGKGQRGLLVSPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT++LQNIA SI +N+PEC+LIVLLIDERPEEVT+M R+V+GEV++STFDE  ARHV
Sbjct: 181 KAGKTLMLQNIATSITRNNPECHLIVLLIDERPEEVTEMSRTVRGEVVASTFDEPPARHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVV+LLDSITRL RAYN ++PSSGK+LTGGVDA+AL++PKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKRDVVVLLDSITRLARAYNTVVPSSGKVLTGGVDAHALEKPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TALVDTGS+MDEVIFEEFKGTGN E  L+RK+A+KR++PA++I
Sbjct: 301 FGAARNIEEGGSLTIIATALVDTGSKMDEVIFEEFKGTGNMEAHLDRKLAEKRVYPALNI 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQ 422
            +SGTR+EDL+    ++Q++++LR++++ M    A EFLID+LK TK N +FF +M ++
Sbjct: 361 RRSGTRREDLIASEDEMQRMWILRKLLNPMEDVAATEFLIDRLKDTKTNLEFFEAMKRR 419


>gi|256828488|ref|YP_003157216.1| transcription termination factor Rho [Desulfomicrobium baculatum
           DSM 4028]
 gi|256577664|gb|ACU88800.1| transcription termination factor Rho [Desulfomicrobium baculatum
           DSM 4028]
          Length = 415

 Score =  561 bits (1447), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 271/417 (64%), Positives = 342/417 (82%), Gaps = 3/417 (0%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK KS ++L+  A   +IEN + +RKQEL+F++L+  + ++  I GEGV+E+L D
Sbjct: 1   MNLSELKTKSMSELMDIAGEYQIENMSGLRKQELIFALLQACASQNGSIFGEGVLEILPD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSP  +Y+ GPDDIYVSPSQI+ F L+TGD + G IR P+EGERYFALL+V  I 
Sbjct: 61  GFGFLRSPMYSYMPGPDDIYVSPSQIRRFGLRTGDVISGQIRPPKEGERYFALLRVKEIC 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           F  PE  +  + FDNLTP+YPD++F +E  +   K+ S+R++DL+ PIGKGQR+LIVAPP
Sbjct: 121 FREPEEAKRIVLFDNLTPIYPDEQFRLENGD---KNYSARILDLMTPIGKGQRALIVAPP 177

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           RTGKT+L+Q+IA+SI  NHP+ YLIVLLIDERPEEVTDM+R+V+ EVISSTFDE   RHV
Sbjct: 178 RTGKTMLMQSIANSISVNHPDAYLIVLLIDERPEEVTDMERTVRAEVISSTFDEPPQRHV 237

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMV+ KAK LVE  +DVV+LLDSITRL RAYN   PSSG++L+GG+DANALQRPKRF
Sbjct: 238 QVAEMVLEKAKRLVERKVDVVVLLDSITRLGRAYNATTPSSGRVLSGGLDANALQRPKRF 297

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TALVDTGSRMDEVIFEEFKGTGNS+I L+R ++DKR+FPA+D+
Sbjct: 298 FGAARNIEEGGSLTIISTALVDTGSRMDEVIFEEFKGTGNSDIYLDRHLSDKRVFPAIDL 357

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
            +SGTRKE+LL+    L KV++LRRI++SMNS D+++FL+DK++ TK NKDF   MN
Sbjct: 358 NRSGTRKEELLLAPDVLNKVWILRRIMASMNSVDSMDFLLDKMRGTKSNKDFLDMMN 414


>gi|253997393|ref|YP_003049457.1| transcription termination factor Rho [Methylotenera mobilis JLW8]
 gi|253984072|gb|ACT48930.1| transcription termination factor Rho [Methylotenera mobilis JLW8]
          Length = 419

 Score =  561 bits (1446), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 267/418 (63%), Positives = 349/418 (83%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L +LK+   T+L+  A + EI+NA+ MRKQ+L+F+ILK  + +   I G+G +EVLQD
Sbjct: 1   MHLSDLKHLPVTELVEMAIANEIDNASRMRKQDLIFAILKNKAKKGESIFGDGTLEVLQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSPD +YLAGPDDIYVSPSQI+ F+L TGD+++G IR P++GERYFAL+KV+ +N
Sbjct: 61  GFGFLRSPDTSYLAGPDDIYVSPSQIRRFNLHTGDSIQGEIRIPKDGERYFALVKVDMVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
            + PE  ++KI F+NLTPL+P     +E +    ++I+SRVID+IAPIGKGQR L+VA P
Sbjct: 121 GEAPENTKHKILFENLTPLFPTIPLTLERDIKGAENITSRVIDMIAPIGKGQRGLLVASP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           ++GKT+++QNIAH+I  NHP+  LIVLLIDERPEEVT+M RSV+GEV++STFDE A RHV
Sbjct: 181 KSGKTVMMQNIAHAITANHPDVILIVLLIDERPEEVTEMTRSVKGEVVASTFDEPATRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMV+ KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRPKRF
Sbjct: 241 QVAEMVLEKAKRLVEHKKDVVILLDSITRLARAYNTVIPSSGKVLTGGVDANALQRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TALVDTGSRMD+VI+EEFKGTGN EI L+R++A+KR +PA+++
Sbjct: 301 FGAARNVEEGGSLTIIATALVDTGSRMDDVIYEEFKGTGNMEIHLDRRMAEKRQYPAINV 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            KSGTR+E+LL+E+  LQK+++LR+++  M+  +A+EFL+DK+K TK+N DFF SM +
Sbjct: 361 NKSGTRREELLIEKDVLQKIWVLRKLLYPMDDLEAMEFLLDKIKSTKNNADFFDSMRR 418


>gi|296113953|ref|YP_003627891.1| transcription termination factor Rho [Moraxella catarrhalis RH4]
 gi|295921647|gb|ADG61998.1| transcription termination factor Rho [Moraxella catarrhalis RH4]
 gi|326559330|gb|EGE09757.1| transcription termination factor Rho [Moraxella catarrhalis 7169]
 gi|326562455|gb|EGE12773.1| transcription termination factor Rho [Moraxella catarrhalis
           46P47B1]
 gi|326564294|gb|EGE14524.1| transcription termination factor Rho [Moraxella catarrhalis
           103P14B1]
 gi|326567228|gb|EGE17348.1| transcription termination factor Rho [Moraxella catarrhalis
           12P80B1]
 gi|326568267|gb|EGE18349.1| transcription termination factor Rho [Moraxella catarrhalis BC8]
 gi|326569967|gb|EGE20014.1| transcription termination factor Rho [Moraxella catarrhalis BC1]
 gi|326570049|gb|EGE20095.1| transcription termination factor Rho [Moraxella catarrhalis BC7]
 gi|326572903|gb|EGE22888.1| transcription termination factor Rho [Moraxella catarrhalis CO72]
 gi|326573850|gb|EGE23803.1| transcription termination factor Rho [Moraxella catarrhalis O35E]
 gi|326574729|gb|EGE24665.1| transcription termination factor Rho [Moraxella catarrhalis
           101P30B1]
          Length = 422

 Score =  561 bits (1446), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 265/420 (63%), Positives = 343/420 (81%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK+KS  +LLA AE + ++N    RKQ+++F+ILK  +     I G GV+E+L D
Sbjct: 1   MNLTELKSKSVGELLAIAEHMGLDNMARSRKQDIIFAILKTHARNGEAIYGNGVLEILPD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS + +YLAGPDDIYVSPSQI+ F+L+TGD++ G IR P++ ERYFALLKV+ IN
Sbjct: 61  GFGFLRSSEGSYLAGPDDIYVSPSQIRRFNLQTGDSIAGQIRPPKDSERYFALLKVSEIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           FD P+R R+K+ F+NLTPL+P ++  +E  N   +D++ R+IDLIAPIGKGQRS+IVAPP
Sbjct: 121 FDTPDRSRHKLIFENLTPLFPTQQLVLEAGNGTTEDLTGRIIDLIAPIGKGQRSIIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQ IA +I KNHPECYLIVLLIDERPEEVT+MQR+V GEV++STFDE   RH+
Sbjct: 181 KAGKTVLLQTIAQAITKNHPECYLIVLLIDERPEEVTEMQRTVWGEVVASTFDEPPQRHI 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDA+AL+RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKQDVVILLDSITRLARAYNTVIPSSGKVLTGGVDAHALERPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TAL+DTGS+MD VIFEEFKGTGN EI LER++A++RIFPA++I
Sbjct: 301 FGAARNVEEGGSLTIISTALIDTGSKMDSVIFEEFKGTGNQEITLERELAERRIFPAINI 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQN 423
            KS TR+E+ L++   L++V++LR+++  M  + A EFL+++LK +K N +FF  M K++
Sbjct: 361 KKSSTRREERLLDEDTLRRVWILRKLMQPMEDAQATEFLLERLKDSKTNDEFFEQMVKKS 420


>gi|124266475|ref|YP_001020479.1| transcription termination factor Rho [Methylibium petroleiphilum
           PM1]
 gi|124259250|gb|ABM94244.1| transcription termination factor Rho [Methylibium petroleiphilum
           PM1]
          Length = 430

 Score =  561 bits (1446), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 264/418 (63%), Positives = 352/418 (84%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK +  ++L+  AE+LEIEN+  MRKQELMF+I+K  + +  ++ G+GV+EVL D
Sbjct: 11  MHLSELKAQHISELIKVAETLEIENSARMRKQELMFAIMKKRAKQGEQVFGDGVLEVLPD 70

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSP+A+YLA  DDIY+SPSQI+ F+L TGD +EG +R P++GERYFAL+KV+ +N
Sbjct: 71  GFGFLRSPEASYLASTDDIYLSPSQIRRFNLHTGDMIEGEVRVPKDGERYFALVKVDIVN 130

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
              PE  + KI F+NLTPL+P ++F +E +    ++I+SR++DLIAP+GKGQR+L+V+ P
Sbjct: 131 GITPEENKQKIMFENLTPLFPKEQFKLERDIKAEENITSRIVDLIAPLGKGQRALLVSAP 190

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           ++GKT+++QN+AH+I  N+PE +LIVLL+DERPEEVT+MQR+++GEVISSTFDE AARHV
Sbjct: 191 KSGKTVMMQNLAHAITANYPEVHLIVLLVDERPEEVTEMQRTIRGEVISSTFDEPAARHV 250

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI +AK LVE   DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRPKRF
Sbjct: 251 QVAEMVIERAKRLVELKKDVVILLDSITRLARAYNNVLPSSGKVLTGGVDANALQRPKRF 310

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTIIGTALVDTGSRMDEVI+EEFKGTGN EI L+R++A+KR++P++ +
Sbjct: 311 FGAARNIEEGGSLTIIGTALVDTGSRMDEVIYEEFKGTGNCEIHLDRRMAEKRVYPSILL 370

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            KSGTR+E+LL++ + LQK ++LR+++ SM+  +A+EF++DK+K TK N DFF  M +
Sbjct: 371 NKSGTRREELLLKPEILQKTWILRKLLYSMDEIEAMEFILDKMKATKTNLDFFDMMRR 428


>gi|298530965|ref|ZP_07018366.1| transcription termination factor Rho [Desulfonatronospira
           thiodismutans ASO3-1]
 gi|298508988|gb|EFI32893.1| transcription termination factor Rho [Desulfonatronospira
           thiodismutans ASO3-1]
          Length = 415

 Score =  561 bits (1446), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 272/418 (65%), Positives = 340/418 (81%), Gaps = 3/418 (0%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L +LK KS  +L+  ++  EIEN + MRKQEL+F+IL+  + ++  + GEGV+E+L D
Sbjct: 1   MNLSDLKTKSMKELMQLSKEYEIENPSGMRKQELIFAILQSCASQNGTVSGEGVLEILPD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSP  +Y+ GPDDIYVSPSQI+ F L+TGD V G IR P+EGERYFALL+VN + 
Sbjct: 61  GFGFLRSPMYSYMPGPDDIYVSPSQIRKFGLRTGDVVSGQIRPPKEGERYFALLRVNQVG 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           F  P   ++ + FDNLTP+YPDKRF +E N  EN  +SSRV+DL++P+G GQR LIVAPP
Sbjct: 121 FGEPSESKSLVLFDNLTPIYPDKRFVLE-NGAEN--LSSRVLDLLSPVGTGQRGLIVAPP 177

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           RTGKT+LLQ+IA+SI  N P+ ++IVLLIDERPEEVTDM+R+V  EV+SSTFDE   RHV
Sbjct: 178 RTGKTVLLQSIANSINANDPDVFMIVLLIDERPEEVTDMERTVDAEVVSSTFDEPPQRHV 237

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMV+ KAK LVE   DVVILLDSITRL RAYN + PSSG++L+GG+D+NALQRPKRF
Sbjct: 238 QVAEMVLEKAKRLVERKKDVVILLDSITRLGRAYNTITPSSGRVLSGGLDSNALQRPKRF 297

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGN EI L+R +ADKR+FPA+DI
Sbjct: 298 FGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNMEIYLDRHLADKRVFPAIDI 357

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            +SGTRKEDLL+    L KV++LR++++ MNS D++EFL+DK+K TK N++F   MNK
Sbjct: 358 NRSGTRKEDLLLSEDVLNKVWILRKVLAPMNSVDSMEFLLDKMKGTKSNREFLDMMNK 415


>gi|330501283|ref|YP_004378152.1| transcription termination factor Rho [Pseudomonas mendocina NK-01]
 gi|328915569|gb|AEB56400.1| transcription termination factor Rho [Pseudomonas mendocina NK-01]
          Length = 419

 Score =  561 bits (1446), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 273/419 (65%), Positives = 348/419 (83%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK K   +LL  AE + +EN    RKQ+++F++LK  +    EI G+GV+E+LQD
Sbjct: 1   MNLTELKQKPIAELLDMAEQMGLENMARSRKQDIIFALLKKHAKSGEEISGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P+EGERYFALLKV++IN
Sbjct: 61  GFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTIVGKIRPPKEGERYFALLKVDSIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           FD PE  +NKI F+NLTPL+P++R  ME  N   +DI+ RVIDL APIGKGQR LIVAPP
Sbjct: 121 FDRPENAKNKILFENLTPLFPNQRLTMEAGNGSTEDITGRVIDLCAPIGKGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKTI+LQNIA +I +N+PE +LIVLLIDERPEEVT+MQR+V+GEV++STFDE   RHV
Sbjct: 181 KAGKTIMLQNIASNITRNNPEVHLIVLLIDERPEEVTEMQRTVRGEVVASTFDEPPTRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDA+AL++PKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVIPSSGKVLTGGVDAHALEKPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTI+ TAL++TGS+MDEVI+EEFKGTGN E++L+R++A+KR FPA++I
Sbjct: 301 FGAARNIEEGGSLTILATALIETGSKMDEVIYEEFKGTGNMELILDRRVAEKRTFPAINI 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQ 422
            KSGTR+E+LL   ++L ++++LR+++  M+   AIEFLIDKLK TK N +FF SM ++
Sbjct: 361 NKSGTRREELLTGEEELSRMWILRKLLHPMDEIAAIEFLIDKLKATKTNDEFFLSMKRK 419


>gi|297539612|ref|YP_003675381.1| transcription termination factor Rho [Methylotenera sp. 301]
 gi|297258959|gb|ADI30804.1| transcription termination factor Rho [Methylotenera sp. 301]
          Length = 419

 Score =  561 bits (1445), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 267/418 (63%), Positives = 349/418 (83%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L +LK+   T+L+  A + EI+NA+ MRKQ+L+F+ILK  + +   I G+G +EVLQD
Sbjct: 1   MHLSDLKHLPVTELVEMAIADEIDNASRMRKQDLIFAILKHKAKKGESIFGDGTLEVLQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSPD +YLAGPDDIYVSPSQI+ F+L TGD+++G IR P++GERYFAL+KV+ +N
Sbjct: 61  GFGFLRSPDTSYLAGPDDIYVSPSQIRRFNLHTGDSIQGEIRIPKDGERYFALVKVDVVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
            + PE  ++KI F+NLTPL+P     +E +    ++I+SRVID+IAPIG+GQR L+VA P
Sbjct: 121 GEAPENTKHKILFENLTPLFPTIPLTLERDIKGVENITSRVIDMIAPIGRGQRGLLVASP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           ++GKT+++QNIAH+I  NHP+  LIVLLIDERPEEVT+M RSV+GEV++STFDE A RHV
Sbjct: 181 KSGKTVMMQNIAHAITANHPDVILIVLLIDERPEEVTEMTRSVRGEVVASTFDEPATRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMV+ KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRPKRF
Sbjct: 241 QVAEMVLEKAKRLVEHKKDVVILLDSITRLARAYNTVIPSSGKVLTGGVDANALQRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TALVDTGSRMD+VI+EEFKGTGN EI L+RK+A+KR +PA+++
Sbjct: 301 FGAARNVEEGGSLTIIATALVDTGSRMDDVIYEEFKGTGNMEIHLDRKMAEKRQYPAINV 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            KSGTR+E+LL+E+  LQK+++LR+++  M+  +A+EFL+DK+K TK+N DFF SM +
Sbjct: 361 NKSGTRREELLIEKDVLQKIWVLRKLLYPMDDLEAMEFLLDKIKATKNNADFFDSMRR 418


>gi|127511271|ref|YP_001092468.1| transcription termination factor Rho [Shewanella loihica PV-4]
 gi|126636566|gb|ABO22209.1| transcription termination factor Rho [Shewanella loihica PV-4]
          Length = 421

 Score =  561 bits (1445), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 270/418 (64%), Positives = 339/418 (81%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK KS + L+  A+ ++IEN    RKQ+++F+ILK  +    +I G GV+E+LQD
Sbjct: 1   MNLSELKEKSISDLVILAQDMKIENMARARKQDIIFAILKAHAKSGEDIFGGGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D +YLAGPDDIYVSPSQI+ F+++TGDT+ G IR P+EGERYFALLKV+ +N
Sbjct: 61  GFGFLRSADGSYLAGPDDIYVSPSQIRRFNMRTGDTIFGKIRPPKEGERYFALLKVSEVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           FD PE  R+KI F+NLTPL+ ++R  ME  N   +DI++R++DL +PIGKGQR LIVAPP
Sbjct: 121 FDKPENSRSKILFENLTPLHAEERIRMERGNGSTEDITARILDLCSPIGKGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA SI  N+PE  L+VLLIDERPEEVT+MQR V+GEV++STFDE A+RHV
Sbjct: 181 KAGKTLLLQNIAQSITYNNPEVVLMVLLIDERPEEVTEMQRLVKGEVVASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANAL RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVIPSSGKVLTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+ GGSLTII TALVDTGS+MDEVI+EEFKGTGN E+ L RK A+KR+FPA+D 
Sbjct: 301 FGAARNIEHGGSLTIIATALVDTGSKMDEVIYEEFKGTGNQELHLSRKAAEKRVFPAIDF 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            +SGTR+E+ L    +LQK+++LR+I++ M+    +EFLIDKL  TK N++FF +M +
Sbjct: 361 NRSGTRREEKLTTPDELQKMWILRKILNPMDEVSGMEFLIDKLAMTKTNEEFFTAMKR 418


>gi|157377243|ref|YP_001475843.1| transcription termination factor Rho [Shewanella sediminis HAW-EB3]
 gi|157319617|gb|ABV38715.1| transcription termination factor Rho [Shewanella sediminis HAW-EB3]
          Length = 421

 Score =  560 bits (1444), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 270/418 (64%), Positives = 338/418 (80%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK+ S + L+  A+ +++EN    RKQ+++FSILK  +    +I G GV+E+LQD
Sbjct: 1   MNLSELKDTSISDLVLLAQEMKVENTARARKQDIIFSILKAHAKSGEDIFGGGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS DA+YLAGPDDIYVSPSQI+ FS++TGD++ G IR P+EGERYFALLKV+ +N
Sbjct: 61  GFGFLRSADASYLAGPDDIYVSPSQIRRFSMRTGDSIFGKIRPPKEGERYFALLKVSEVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           FD PE  R KI F+NLTPL+ ++R  ME  N   +DI+SR++DL +PIGKGQR LIVAPP
Sbjct: 121 FDKPENSRTKILFENLTPLHAEERMRMERGNGSTEDITSRILDLCSPIGKGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQN+A SI  N+P+  L+VLLIDERPEEVT+MQR V+GEVI+STFDE A+RHV
Sbjct: 181 KAGKTLLLQNMAQSITYNNPDVVLMVLLIDERPEEVTEMQRMVKGEVIASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANAL RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVIPSSGKVLTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+ GGSLTII TALVDTGS+MDEVI+EEFKGTGN E+ L RK A+KR+FPA+D 
Sbjct: 301 FGAARNIEHGGSLTIIATALVDTGSKMDEVIYEEFKGTGNQELHLSRKAAEKRVFPAIDF 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            +SGTR+E+ L    +LQK+++LR+I++ M+    +EFLIDKL  TK N +FF +M +
Sbjct: 361 NRSGTRREEKLTTPDELQKMWILRKILNPMDEVTGMEFLIDKLAMTKTNDEFFKAMKR 418


>gi|332284683|ref|YP_004416594.1| transcription termination factor Rho [Pusillimonas sp. T7-7]
 gi|330428636|gb|AEC19970.1| transcription termination factor Rho [Pusillimonas sp. T7-7]
          Length = 418

 Score =  560 bits (1444), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 258/418 (61%), Positives = 349/418 (83%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK +  +KLL  A  LEI+NA+ +RKQELMF+I+K  + +  +I G+GV+EVL D
Sbjct: 1   MHLTELKTQHVSKLLEMAAELEIDNASRLRKQELMFAIMKRRAKQGEQIFGDGVLEVLPD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSP+ +YLA PDDIY+SPSQI+ F+L TGD++EG +R P++GERYFAL+KV+ +N
Sbjct: 61  GFGFLRSPETSYLASPDDIYISPSQIRRFNLHTGDSIEGEVRTPKDGERYFALVKVDKVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
              PE ++++I FDNLTPL+PD+   +E N    ++ + R++D+ AP+GKGQR+LIVA P
Sbjct: 121 GMQPETIKHRIMFDNLTPLHPDEVMTLERNIKSEENTTGRILDIFAPMGKGQRALIVASP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           ++GKT+++Q+IAH+I  N+P+  +IV+L+DERPEEVT+MQR+V+GEV++STFDE A RHV
Sbjct: 181 KSGKTVMMQHIAHAISANYPDAIMIVMLVDERPEEVTEMQRTVRGEVVASTFDEPATRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE   DVVILLDSITRL RAYN ++P+SGK+LTGGVDANALQRPKRF
Sbjct: 241 QVAEMVIEKAKRLVELKKDVVILLDSITRLARAYNTVVPASGKVLTGGVDANALQRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTIIGTALV+TGSRMDEVI+EEFKGTGNSE+ LER++A+KR++PA+++
Sbjct: 301 FGAARNVEEGGSLTIIGTALVETGSRMDEVIYEEFKGTGNSEVHLERRLAEKRVYPAINL 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            KSGTR+E+LL++ + LQKV++LR+ +  M+  +A+EF++DK++ TK N +FF  M K
Sbjct: 361 NKSGTRREELLIKPELLQKVWVLRKFIHDMDEIEAMEFILDKIRATKTNSEFFDMMKK 418


>gi|258404970|ref|YP_003197712.1| transcription termination factor Rho [Desulfohalobium retbaense DSM
           5692]
 gi|257797197|gb|ACV68134.1| transcription termination factor Rho [Desulfohalobium retbaense DSM
           5692]
          Length = 415

 Score =  560 bits (1444), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 269/417 (64%), Positives = 338/417 (81%), Gaps = 3/417 (0%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L E+K KS  +L+  A+  ++EN + +RKQEL+F+IL   + ++  I GEGV+E+L D
Sbjct: 1   MNLSEMKRKSMAELMQLAKEYKVENPSGLRKQELIFAILSSCASQNGSIYGEGVLEILPD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSP  +Y+ GPDDIYVSPSQI+ F L+ GD V G IR P+EGERYFALL+V  + 
Sbjct: 61  GFGFLRSPMYSYIPGPDDIYVSPSQIRRFGLRKGDVVSGQIRPPKEGERYFALLRVQQVG 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           F  PE  +N + FDNLTP+YPD+RF ME      +  SSRV+DL+APIGKGQR LIVAPP
Sbjct: 121 FATPEESKNLVLFDNLTPIYPDQRFVMETGA---ESYSSRVVDLLAPIGKGQRGLIVAPP 177

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           RTGKT+LLQ+IA+SI  NHP+ YLIVLLIDERPEEVTDM+R+V GEV+SSTFDE   RHV
Sbjct: 178 RTGKTMLLQSIANSITANHPDSYLIVLLIDERPEEVTDMERTVDGEVVSSTFDEPPQRHV 237

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMV+ KAK LVE   DVVILLDSITR  RA+N ++PSSG++L+GG+D+NALQRPKRF
Sbjct: 238 QVAEMVLEKAKRLVERKKDVVILLDSITRFGRAHNAIIPSSGRVLSGGLDSNALQRPKRF 297

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGN EI L+R +ADKR+FPA+DI
Sbjct: 298 FGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNMEIYLDRHLADKRVFPAIDI 357

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
            +SGTRKEDLL++   L +V++LR++++ MNS +++EFL+DK++ TK N++F   MN
Sbjct: 358 NRSGTRKEDLLLDENVLNRVWILRKLLAPMNSVESMEFLLDKMRGTKSNREFLDMMN 414


>gi|261856915|ref|YP_003264198.1| transcription termination factor Rho [Halothiobacillus neapolitanus
           c2]
 gi|261837384|gb|ACX97151.1| transcription termination factor Rho [Halothiobacillus neapolitanus
           c2]
          Length = 419

 Score =  560 bits (1444), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 259/418 (61%), Positives = 344/418 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK K    LLA AES+ IEN    RK +++F++LK  +     I G+GV+E+L D
Sbjct: 1   MNLTELKAKPVADLLAMAESMGIENIARTRKHDVIFALLKAHAKSGESIFGDGVLEILPD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLR  D++YLAGP D+YVSPSQI+ F+L+TGDT+ G++R+P++GERYFALLK++ IN
Sbjct: 61  GFGFLRGADSSYLAGPADVYVSPSQIRRFNLQTGDTIAGTVRSPKDGERYFALLKIDTIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           F+ P   + K+ F+NLTPL+ ++R  ME  N   +D+++R+ID+++P+GKGQR LIVAPP
Sbjct: 121 FEAPNMAKGKVLFENLTPLHANQRMRMERGNGSTEDLTARIIDIVSPVGKGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQNIA SI  NHPEC LIVLLIDERPEEVT+MQR+V+GEV++STFDE A RHV
Sbjct: 181 KAGKTMLLQNIAQSISANHPECDLIVLLIDERPEEVTEMQRTVRGEVVASTFDEPATRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DV+ILLDSITRL RAYN ++PSSGK+LTGGVDANAL RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKRDVIILLDSITRLARAYNTVVPSSGKVLTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTI+ TAL+DTGS+MDEVI+EEFKGTGN E+ L+R+IA+KR++PA++I
Sbjct: 301 FGAARNIEEGGSLTILATALIDTGSKMDEVIYEEFKGTGNMELHLDRRIAEKRVYPAINI 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            +SGTR+E+LL + ++LQK+++LR+ +  M+  +++EFL+DKL +TK N +F+ SM +
Sbjct: 361 NRSGTRREELLTDAEELQKMWILRKFLHPMSELESMEFLLDKLLKTKTNNEFYDSMRR 418


>gi|254000027|ref|YP_003052090.1| transcription termination factor Rho [Methylovorus sp. SIP3-4]
 gi|313202003|ref|YP_004040661.1| transcription termination factor rho [Methylovorus sp. MP688]
 gi|253986706|gb|ACT51563.1| transcription termination factor Rho [Methylovorus sp. SIP3-4]
 gi|312441319|gb|ADQ85425.1| transcription termination factor Rho [Methylovorus sp. MP688]
          Length = 419

 Score =  560 bits (1444), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 266/418 (63%), Positives = 350/418 (83%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L +LK+   T+L+  A + EIE A+ MRKQ+L+F++LK  + +   I G+G +EVLQD
Sbjct: 1   MHLSDLKHLPVTELVEMAIANEIEGASRMRKQDLIFALLKNKAKKGDSIFGDGTLEVLQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSPD +YLAGPDDIYVSPSQI+ F+L TGD++ G IR P++GERYFAL+KV+++N
Sbjct: 61  GFGFLRSPDTSYLAGPDDIYVSPSQIRRFNLHTGDSIMGEIRTPKDGERYFALVKVDSVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
            + PE  ++KI F+NLTPL+P K   +E +    ++++ RVID+IAPIGKGQR+L+VAPP
Sbjct: 121 GEAPENTKHKILFENLTPLFPTKPLVLERDIRGEENVTGRVIDMIAPIGKGQRALLVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           ++GKT+++Q+IAH+I  NHP+  LIVLLIDERPEEVT+M RSV+GEV++STFDE A RHV
Sbjct: 181 KSGKTVMMQHIAHAITANHPDVSLIVLLIDERPEEVTEMTRSVKGEVVASTFDEPATRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMV+ KAK LVE+  DVVILLDSITRL RAYN ++P+SGK+LTGGVDANALQRPKRF
Sbjct: 241 QVAEMVLEKAKRLVEHKKDVVILLDSITRLARAYNTVVPASGKVLTGGVDANALQRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TALVDTGSRMD+VI+EEFKGTGN EI L+R++A+KR +PA+++
Sbjct: 301 FGAARNIEEGGSLTIIATALVDTGSRMDDVIYEEFKGTGNMEIHLDRRMAEKRQYPAINV 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            KSGTR+E+LL+E+  LQK+++LR+++  M+  +A+EFL+DKLK TK+N DFF SM +
Sbjct: 361 NKSGTRREELLIEKDILQKIWVLRKLLYPMDDLEAMEFLLDKLKATKNNADFFDSMRR 418


>gi|157960226|ref|YP_001500260.1| transcription termination factor Rho [Shewanella pealeana ATCC
           700345]
 gi|157845226|gb|ABV85725.1| transcription termination factor Rho [Shewanella pealeana ATCC
           700345]
          Length = 421

 Score =  560 bits (1442), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 270/418 (64%), Positives = 336/418 (80%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK+ S + L+  A+ +++EN    RKQ+++FSILK  +    +I G GV+E+LQD
Sbjct: 1   MNLSELKDTSISDLVQLAQDMKLENMARARKQDIIFSILKAHAKSGEDIFGGGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D +YLAGPDDIYVSPSQI+ F+++TGDT+ G IR P+EGERYFALLKV  +N
Sbjct: 61  GFGFLRSSDGSYLAGPDDIYVSPSQIRRFNMRTGDTIFGKIRPPKEGERYFALLKVTEVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           FD PE  RNKI F+NLTPL+ ++R  ME  N   +DI+SR++DL +PIGKGQR LIVAPP
Sbjct: 121 FDKPENSRNKILFENLTPLHAEERMRMERGNGSTEDITSRILDLCSPIGKGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQ +A SI  N+PE  L+VLLIDERPEEVT+MQR V+GEVI+STFDE A+RHV
Sbjct: 181 KAGKTLLLQTMAQSITYNNPEVVLMVLLIDERPEEVTEMQRMVKGEVIASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANAL RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVIPSSGKVLTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+ GGSLTII TALVDTGS+MDEVI+EEFKGTGN E+ L RK A+KR+FPA+D 
Sbjct: 301 FGAARNIEHGGSLTIIATALVDTGSKMDEVIYEEFKGTGNQELHLSRKAAEKRVFPAIDF 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            +SGTR+E+ L    +LQK+++LR+I++ M+    +EFLIDKL  TK N +FF +M +
Sbjct: 361 NRSGTRREEKLTTPDELQKMWILRKILNPMDEVTGMEFLIDKLAMTKTNDEFFTAMKR 418


>gi|162456215|ref|YP_001618582.1| transcription termination factor Rho [Sorangium cellulosum 'So ce
           56']
 gi|161166797|emb|CAN98102.1| transcription termination factor Rho [Sorangium cellulosum 'So ce
           56']
          Length = 415

 Score =  560 bits (1442), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 271/418 (64%), Positives = 339/418 (81%), Gaps = 3/418 (0%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L+ELK K   +L+  A+ L IE A  +RKQE++F++L+  + +D  + GEGV+E L D
Sbjct: 1   MHLRELKQKPMAELVQMAKGLNIEGAAGLRKQEVIFALLQAHAAQDQPVYGEGVLECLPD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLR+PD NYL GPDDIYVSPSQI+ F+L+TGD+V GSIR P+E E YFALLKV+ IN
Sbjct: 61  GFGFLRAPDYNYLPGPDDIYVSPSQIRRFNLRTGDSVSGSIRPPKEREAYFALLKVDKIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
            + PE  R+KI FDNLTPLYP ++FN+E      K  S+R+ID++ PIGKGQR LIV+PP
Sbjct: 121 GEPPEVARDKILFDNLTPLYPQQKFNIENGT---KSFSTRIIDMLCPIGKGQRCLIVSPP 177

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           R GKT+LLQ IA++I  NHP+  LIVLLIDERPEEVTDMQR+V+GEVISSTFDE   RHV
Sbjct: 178 RAGKTVLLQQIANAISANHPDTTLIVLLIDERPEEVTDMQRTVKGEVISSTFDEPPTRHV 237

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++P SGKIL+GGVD+NAL +PKRF
Sbjct: 238 QVAEMVIEKAKRLVEHKHDVVILLDSITRLARAYNTVVPPSGKILSGGVDSNALHKPKRF 297

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTI+ TALVDTGSRMDEVIFEEFKGTGNSEI L+RK+ +KRIFP +DI
Sbjct: 298 FGAARNVEEGGSLTIVATALVDTGSRMDEVIFEEFKGTGNSEIHLDRKLMEKRIFPCLDI 357

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            KS TRKE+LL+    LQ+V++LR+++  +N  D++EFL+DK+ +T+ N++F  SMN+
Sbjct: 358 NKSATRKEELLLPEWILQRVWLLRQLLHPLNVIDSMEFLLDKVSRTETNQEFLESMNQ 415


>gi|313672257|ref|YP_004050368.1| transcription termination factor rho [Calditerrivibrio
           nitroreducens DSM 19672]
 gi|312939013|gb|ADR18205.1| transcription termination factor Rho [Calditerrivibrio
           nitroreducens DSM 19672]
          Length = 413

 Score =  559 bits (1441), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 276/418 (66%), Positives = 344/418 (82%), Gaps = 5/418 (1%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L +LK KS  +LL+ AE + IENA  M +QEL+F ILK  S R+ +I G+GV+E+L D
Sbjct: 1   MNLDDLKKKSVEELLSIAEGINIENAPNMLRQELIFEILKATSQRNGQIYGQGVLEILPD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D NYL GPDDIYVSP+QI+ F L+ GDT+ G IR PR+ E+YFALLK+ +IN
Sbjct: 61  GFGFLRSQDYNYLPGPDDIYVSPAQIRKFGLRNGDTIAGEIRPPRDNEKYFALLKIESIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           FD  +  RN   F+NLTPL+PD+R ++E   P + D  +R+++LIAP+GKGQR LIVAPP
Sbjct: 121 FDEVKLHRNL--FENLTPLFPDERIDLEAF-PTHYD--TRIMNLIAPVGKGQRGLIVAPP 175

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           +TGKT+LL++IA+SI KNHPE YLI+LLIDERPEEVTDMQRSV+ EV+SSTFDE A RHV
Sbjct: 176 KTGKTMLLKSIANSITKNHPEIYLIILLIDERPEEVTDMQRSVKAEVVSSTFDEPAYRHV 235

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMV+ KAK LVE+  DV ILLDSITRL RAYN + PSSGK+L+GGVD+NAL +PKRF
Sbjct: 236 QVAEMVLNKAKRLVEHKRDVCILLDSITRLARAYNSIEPSSGKVLSGGVDSNALHKPKRF 295

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGN E+ L+RK+ +KRIFPA+DI
Sbjct: 296 FGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNMELHLDRKLVEKRIFPAIDI 355

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            +SGTR+E+LL+ + ++ KV++LRR +S MNS DA+EFL++K+K TK NK+F  SMNK
Sbjct: 356 NRSGTRREELLLAKDEINKVWILRRFLSGMNSVDAMEFLLEKIKDTKTNKEFLNSMNK 413


>gi|52425892|ref|YP_089029.1| transcription termination factor Rho [Mannheimia succiniciproducens
           MBEL55E]
 gi|52307944|gb|AAU38444.1| Rho protein [Mannheimia succiniciproducens MBEL55E]
          Length = 452

 Score =  559 bits (1441), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 273/419 (65%), Positives = 339/419 (80%), Gaps = 1/419 (0%)

Query: 4   MKLQELKNKSPTKLLAFAES-LEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQ 62
           M L ELKN   ++L+A  E  + +EN   +RKQ+++F+ILK  +    +I G G++E+L 
Sbjct: 33  MHLTELKNTPVSELVALGEGQMGLENLARLRKQDIVFAILKQHAKSGEDIFGGGILEILP 92

Query: 63  DGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAI 122
           DGFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGD +EG IR P+EGERYFALLKV+ +
Sbjct: 93  DGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLQTGDKIEGKIRPPKEGERYFALLKVDQV 152

Query: 123 NFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAP 182
           N D PE  R+KI F+NLTPL+ + R  ME  N   +D+++R++DL +PIGKGQR LIVAP
Sbjct: 153 NDDKPEVSRSKILFENLTPLHANSRLRMERGNGSTEDLTARILDLASPIGKGQRGLIVAP 212

Query: 183 PRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARH 242
           P+ GKT+LLQNIA SI  N+PEC LIVLLIDERPEEVT+MQRSV+GEVI+STFDE A+RH
Sbjct: 213 PKAGKTMLLQNIAQSITHNYPECELIVLLIDERPEEVTEMQRSVKGEVIASTFDEPASRH 272

Query: 243 VQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKR 302
           VQVAEMVI KAK  VE+  DVVILLDSITRL RAYN + P+SGKIL+GGVDANAL RPKR
Sbjct: 273 VQVAEMVIEKAKRSVEHKKDVVILLDSITRLARAYNTVTPASGKILSGGVDANALHRPKR 332

Query: 303 FFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMD 362
           FFGAARN++EGGSLTII TALVDTGS+MDEVIFEEFKGTGN E+ L RKIA+KR+FPA+D
Sbjct: 333 FFGAARNVEEGGSLTIIATALVDTGSKMDEVIFEEFKGTGNMELHLSRKIAEKRVFPAID 392

Query: 363 IIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
             +SGTRKEDLL    +LQK+++LR+I++ M   +A+EFLIDKL   K N++FF  M +
Sbjct: 393 FNRSGTRKEDLLTTPDELQKMWILRKILNPMGEVEAMEFLIDKLMVAKTNEEFFEIMKR 451


>gi|300691834|ref|YP_003752829.1| transcription termination factor Rho [Ralstonia solanacearum PSI07]
 gi|299078894|emb|CBJ51555.1| transcription termination factor Rho [Ralstonia solanacearum PSI07]
          Length = 420

 Score =  559 bits (1440), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 262/418 (62%), Positives = 345/418 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK+   ++LL  A  LEI+NA  MRKQELMF+ILK  + +   I G+G +EVL D
Sbjct: 1   MHLTELKSLHVSQLLEMAGQLEIDNAQRMRKQELMFAILKKRAKQGETIFGDGTLEVLPD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSP+ +YLA  DDIY+SPSQI+ F+L TGDT+EG +R P++GERYFAL+KV+ +N
Sbjct: 61  GFGFLRSPETSYLASTDDIYISPSQIRRFNLHTGDTIEGEVRTPKDGERYFALVKVDKVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
              PE V+N+I F+NLTPL+P++   +E +    ++I+ R+ID+IAPIG+GQR+L+VA P
Sbjct: 121 TQPPEAVKNRIMFENLTPLHPNRTLTLERDIKAEENITGRIIDMIAPIGRGQRALLVASP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           ++GKT++LQ+IAH+I  NHPE  L VLLIDERPEEVT+MQR+V+GEV++STFDE A RHV
Sbjct: 181 KSGKTVMLQHIAHAITANHPEAELFVLLIDERPEEVTEMQRTVRGEVVASTFDEPAVRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE   DVVI+LDSITRL RAYN ++P+SGK+LTGGVDANALQRPKRF
Sbjct: 241 QVAEMVIEKAKRLVELKKDVVIVLDSITRLARAYNTVVPTSGKVLTGGVDANALQRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTIIGTAL++TGSRMD+VI+EEFKGTGN E+ LER++A+KR++PA+++
Sbjct: 301 FGAARNLEEGGSLTIIGTALIETGSRMDDVIYEEFKGTGNMEVHLERRLAEKRVYPAINL 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            KSGTR+E+LL++   LQKV++LR+ +  M+  +A+EFL+DKLK TK+N +FF  M +
Sbjct: 361 NKSGTRREELLIKPDILQKVWILRKFIHDMDEVEAMEFLLDKLKSTKNNAEFFDMMRR 418


>gi|17545906|ref|NP_519308.1| transcription termination factor Rho [Ralstonia solanacearum
           GMI1000]
 gi|17428201|emb|CAD14889.1| probable transcription termination factor rho (helicase) protein
           [Ralstonia solanacearum GMI1000]
          Length = 420

 Score =  559 bits (1440), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 262/418 (62%), Positives = 345/418 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK+   ++LL  A  LEI+NA  MRKQELMF+ILK  + +   I G+G +EVL D
Sbjct: 1   MHLTELKSLHVSQLLEMAGQLEIDNAQRMRKQELMFAILKKKAKQGETIFGDGTLEVLPD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSP+ +YLA  DDIY+SPSQI+ F+L TGDT+EG +R P++GERYFAL+KV+ +N
Sbjct: 61  GFGFLRSPETSYLASTDDIYISPSQIRRFNLHTGDTIEGEVRTPKDGERYFALVKVDKVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
              PE V+N+I F+NLTPL+P++   +E +    ++I+ R+ID+IAPIG+GQR+L+VA P
Sbjct: 121 AQPPEAVKNRIMFENLTPLHPNRTLTLERDIKAEENITGRIIDMIAPIGRGQRALLVASP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           ++GKT++LQ+IAH+I  NHPE  L VLLIDERPEEVT+MQR+V+GEV++STFDE A RHV
Sbjct: 181 KSGKTVMLQHIAHAITANHPEAELFVLLIDERPEEVTEMQRTVRGEVVASTFDEPAVRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE   DVVI+LDSITRL RAYN ++P+SGK+LTGGVDANALQRPKRF
Sbjct: 241 QVAEMVIEKAKRLVELKKDVVIVLDSITRLARAYNTVVPTSGKVLTGGVDANALQRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTIIGTAL++TGSRMD+VI+EEFKGTGN E+ LER++A+KR++PA+++
Sbjct: 301 FGAARNLEEGGSLTIIGTALIETGSRMDDVIYEEFKGTGNMEVHLERRLAEKRVYPAINL 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            KSGTR+E+LL++   LQKV++LR+ +  M+  +A+EFL+DKLK TK+N +FF  M +
Sbjct: 361 NKSGTRREELLIKPDILQKVWILRKFIHDMDEVEAMEFLLDKLKSTKNNAEFFDMMRR 418


>gi|187928124|ref|YP_001898611.1| transcription termination factor Rho [Ralstonia pickettii 12J]
 gi|241662727|ref|YP_002981087.1| transcription termination factor Rho [Ralstonia pickettii 12D]
 gi|309782350|ref|ZP_07677076.1| transcription termination factor Rho [Ralstonia sp. 5_7_47FAA]
 gi|187725014|gb|ACD26179.1| transcription termination factor Rho [Ralstonia pickettii 12J]
 gi|240864754|gb|ACS62415.1| transcription termination factor Rho [Ralstonia pickettii 12D]
 gi|308918886|gb|EFP64557.1| transcription termination factor Rho [Ralstonia sp. 5_7_47FAA]
          Length = 420

 Score =  559 bits (1440), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 263/418 (62%), Positives = 345/418 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK+   ++LL  A  LEI+NA  MRKQELMF+ILK  + +   I G+G +EVL D
Sbjct: 1   MHLTELKSLHVSQLLEMAGQLEIDNAQRMRKQELMFAILKKKAKQGETIFGDGTLEVLPD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSP+ +YLA  DDIY+SPSQI+ F+L TGDT+EG +R P++GERYFAL+KV+ +N
Sbjct: 61  GFGFLRSPETSYLASTDDIYISPSQIRRFNLHTGDTIEGEVRTPKDGERYFALVKVDKVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
              PE V+N+I F+NLTPL+P+K   +E +    ++I+ R+ID+IAPIG+GQR+L+VA P
Sbjct: 121 TQPPEAVKNRIMFENLTPLHPNKPLTLERDIKAEENITGRIIDMIAPIGRGQRALLVASP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           ++GKT++LQ+IAH+I  NHPE  L VLLIDERPEEVT+MQR+V+GEV++STFDE A RHV
Sbjct: 181 KSGKTVMLQHIAHAIATNHPEAELFVLLIDERPEEVTEMQRTVRGEVVASTFDEPAVRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE   DVVI+LDSITRL RAYN ++P+SGK+LTGGVDANALQRPKRF
Sbjct: 241 QVAEMVIEKAKRLVELKKDVVIVLDSITRLARAYNTVVPTSGKVLTGGVDANALQRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTIIGTAL++TGSRMD+VI+EEFKGTGN E+ LER++A+KR++PA+++
Sbjct: 301 FGAARNLEEGGSLTIIGTALIETGSRMDDVIYEEFKGTGNMEVHLERRLAEKRVYPAINL 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            KSGTR+E+LL++   LQKV++LR+ +  M+  +A+EFL+DKLK TK+N +FF  M +
Sbjct: 361 NKSGTRREELLIKPDILQKVWILRKFIHDMDEVEAMEFLLDKLKTTKNNAEFFDMMRR 418


>gi|83749756|ref|ZP_00946732.1| Rho [Ralstonia solanacearum UW551]
 gi|207743473|ref|YP_002259865.1| transcription termination factor rho (helicase) protein [Ralstonia
           solanacearum IPO1609]
 gi|83723576|gb|EAP70778.1| Rho [Ralstonia solanacearum UW551]
 gi|206594870|emb|CAQ61797.1| transcription termination factor rho (helicase) protein [Ralstonia
           solanacearum IPO1609]
 gi|299067239|emb|CBJ38436.1| transcription termination factor Rho [Ralstonia solanacearum CMR15]
          Length = 420

 Score =  559 bits (1440), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 262/418 (62%), Positives = 345/418 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK+   ++LL  A  LEI+NA  MRKQELMF+ILK  + +   I G+G +EVL D
Sbjct: 1   MHLTELKSLHVSQLLEMAGQLEIDNAQRMRKQELMFAILKKKAKQGETIFGDGTLEVLPD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSP+ +YLA  DDIY+SPSQI+ F+L TGDT+EG +R P++GERYFAL+KV+ +N
Sbjct: 61  GFGFLRSPETSYLASTDDIYISPSQIRRFNLHTGDTIEGEVRTPKDGERYFALVKVDKVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
              PE V+N+I F+NLTPL+P++   +E +    ++I+ R+ID+IAPIG+GQR+L+VA P
Sbjct: 121 TQPPEAVKNRIMFENLTPLHPNRTLTLERDIKAEENITGRIIDMIAPIGRGQRALLVASP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           ++GKT++LQ+IAH+I  NHPE  L VLLIDERPEEVT+MQR+V+GEV++STFDE A RHV
Sbjct: 181 KSGKTVMLQHIAHAITANHPEAELFVLLIDERPEEVTEMQRTVRGEVVASTFDEPAVRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE   DVVI+LDSITRL RAYN ++P+SGK+LTGGVDANALQRPKRF
Sbjct: 241 QVAEMVIEKAKRLVELKKDVVIVLDSITRLARAYNTVVPTSGKVLTGGVDANALQRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTIIGTAL++TGSRMD+VI+EEFKGTGN E+ LER++A+KR++PA+++
Sbjct: 301 FGAARNLEEGGSLTIIGTALIETGSRMDDVIYEEFKGTGNMEVHLERRLAEKRVYPAINL 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            KSGTR+E+LL++   LQKV++LR+ +  M+  +A+EFL+DKLK TK+N +FF  M +
Sbjct: 361 NKSGTRREELLIKPDILQKVWILRKFIHDMDEVEAMEFLLDKLKSTKNNAEFFDMMRR 418


>gi|218885595|ref|YP_002434916.1| transcription termination factor Rho [Desulfovibrio vulgaris str.
           'Miyazaki F']
 gi|218756549|gb|ACL07448.1| transcription termination factor Rho [Desulfovibrio vulgaris str.
           'Miyazaki F']
          Length = 416

 Score =  558 bits (1439), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 272/419 (64%), Positives = 341/419 (81%), Gaps = 4/419 (0%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK KS ++L+  AE   +E A+ MRKQEL+F++L+  + ++  I G+GV+E+L D
Sbjct: 1   MNLSELKIKSMSELMELAEQYNVEGASGMRKQELIFALLQACASQNGAIYGDGVLEILPD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSP  +Y+ GPDDIYVSPSQI+ F+L+ GD V G IR P+EGERYFALLKV  I 
Sbjct: 61  GFGFLRSPLCSYMPGPDDIYVSPSQIRRFNLRKGDVVSGQIRPPKEGERYFALLKVTEIG 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           F+ PE  +N + FDNLTP+YPD++F ME  +   K+ SSRVID++AP+G+GQR LIVAPP
Sbjct: 121 FEPPENAKNLVLFDNLTPIYPDRQFIMENGD---KNYSSRVIDMMAPVGRGQRGLIVAPP 177

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQ-GEVISSTFDESAARH 242
           RTGKTILLQ IA+SI  NHP+ YLIVLLIDERPEEVTDM+R+V+  EV+SSTFDE   RH
Sbjct: 178 RTGKTILLQTIANSINANHPDAYLIVLLIDERPEEVTDMERTVKNAEVVSSTFDEPPQRH 237

Query: 243 VQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKR 302
           VQV EMV+ KAK LVE   DVVILLDSITRL RAYN + PSSG++L+GG+DANALQRPKR
Sbjct: 238 VQVCEMVLEKAKRLVERKRDVVILLDSITRLGRAYNAVTPSSGRVLSGGLDANALQRPKR 297

Query: 303 FFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMD 362
           FFGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGN EI LER +A+KR+FPA+D
Sbjct: 298 FFGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNMEIYLERHLAEKRVFPAID 357

Query: 363 IIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
           I ++GTRKEDLL+  + L +V++LR+I++ M+  D++EFL+DK++ TK N++F   MNK
Sbjct: 358 INRTGTRKEDLLLSDEVLNRVWILRKILAPMSPIDSMEFLLDKMRATKSNREFLNVMNK 416


>gi|300704442|ref|YP_003746045.1| transcription termination factor rho [Ralstonia solanacearum
           CFBP2957]
 gi|299072106|emb|CBJ43438.1| transcription termination factor Rho [Ralstonia solanacearum
           CFBP2957]
          Length = 420

 Score =  558 bits (1439), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 262/418 (62%), Positives = 345/418 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK+   ++LL  A  LEI+NA  MRKQELMF+ILK  + +   I G+G +EVL D
Sbjct: 1   MHLTELKSLHVSQLLEMAGQLEIDNAQRMRKQELMFAILKKKAKQGETIFGDGTLEVLPD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSP+ +YLA  DDIY+SPSQI+ F+L TGDT+EG +R P++GERYFAL+KV+ +N
Sbjct: 61  GFGFLRSPETSYLASTDDIYISPSQIRRFNLHTGDTIEGEVRTPKDGERYFALVKVDKVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
              PE V+N+I F+NLTPL+P++   +E +    ++I+ R+ID+IAPIG+GQR+L+VA P
Sbjct: 121 TQPPEAVKNRIMFENLTPLHPNRTLTLERDIKAEENITGRIIDMIAPIGRGQRALLVASP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           ++GKT++LQ+IAH+I  NHPE  L VLLIDERPEEVT+MQR+V+GEV++STFDE A RHV
Sbjct: 181 KSGKTVMLQHIAHAITANHPEAELFVLLIDERPEEVTEMQRTVRGEVVASTFDEPAVRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE   DVVI+LDSITRL RAYN ++P+SGK+LTGGVDANALQRPKRF
Sbjct: 241 QVAEMVIEKAKRLVELKKDVVIVLDSITRLARAYNTVVPTSGKVLTGGVDANALQRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTIIGTAL++TGSRMD+VI+EEFKGTGN E+ LER++A+KR++PA+++
Sbjct: 301 FGAARNLEEGGSLTIIGTALIETGSRMDDVIYEEFKGTGNMEVHLERRLAEKRVYPAINL 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            KSGTR+E+LL++   LQKV++LR+ +  M+  +A+EFL+DKLK TK+N +FF  M +
Sbjct: 361 NKSGTRREELLIKPDILQKVWILRKFIHDMDEVEAMEFLLDKLKSTKNNAEFFDMMRR 418


>gi|82703205|ref|YP_412771.1| transcription termination factor Rho [Nitrosospira multiformis ATCC
           25196]
 gi|82411270|gb|ABB75379.1| transcription termination factor Rho [Nitrosospira multiformis ATCC
           25196]
          Length = 419

 Score =  558 bits (1439), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 267/418 (63%), Positives = 349/418 (83%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L +LKN   T+L+  A + EI+ AN +RKQ+L+F++LK  + +   I GEG +EVLQD
Sbjct: 1   MHLSDLKNFHVTELVEMAIANEIDGANRLRKQDLIFALLKNQARKGESIFGEGTLEVLQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSPD +YLAGPDDIYVSPSQI+ F+L TGD++EG IR P++GERYFAL+KV+ +N
Sbjct: 61  GFGFLRSPDTSYLAGPDDIYVSPSQIRRFNLHTGDSIEGEIRTPKDGERYFALVKVDKVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
            + PE  ++KI F+NLTPL+P +R  +E      ++++SR+IDLIAPIGKGQR L+VA P
Sbjct: 121 GEPPENSKHKILFENLTPLFPTERLQLEREIKAEENVTSRIIDLIAPIGKGQRGLLVASP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           ++GKT++LQ+IAH+I  N+P+  L+VLLIDERPEEVT+M RSV+GEVISSTFDE A RHV
Sbjct: 181 KSGKTVMLQHIAHAIAANYPDVMLMVLLIDERPEEVTEMIRSVRGEVISSTFDEPAVRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVA+MVI KAK LVE+  DVVILLDSITRL RAYN ++P+SGK+LTGGVDANALQRPKRF
Sbjct: 241 QVADMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVVPASGKVLTGGVDANALQRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTII TALVDTGSRMD+VI+EEFKGTGN EI L+R++A+KRI+PA+++
Sbjct: 301 FGAARNIEEGGSLTIIATALVDTGSRMDDVIYEEFKGTGNMEIHLDRRMAEKRIYPAINV 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            +SGTR+E+LL++   LQK+++LR+++  M+  +A+EFL+DK+K TK+N DFF SM +
Sbjct: 361 NRSGTRREELLIKPDVLQKIWVLRKLLYPMDDMEAMEFLLDKIKATKNNADFFDSMRR 418


>gi|291613478|ref|YP_003523635.1| transcription termination factor Rho [Sideroxydans lithotrophicus
           ES-1]
 gi|291583590|gb|ADE11248.1| transcription termination factor Rho [Sideroxydans lithotrophicus
           ES-1]
          Length = 418

 Score =  558 bits (1439), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 262/418 (62%), Positives = 348/418 (83%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L +LK K  T+L+  A + +I+NAN MRKQ+L+F++LK  + +   I GEG +EVL D
Sbjct: 1   MHLSDLKTKHITELVEMATANQIDNANRMRKQDLIFALLKNQAKKGESIFGEGTLEVLPD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSPD +YLAGPDDIYVSPSQ++ F+L TGD++EG IR P+EGERY AL+KV+ +N
Sbjct: 61  GFGFLRSPDTSYLAGPDDIYVSPSQVRRFNLHTGDSIEGEIRTPKEGERYVALVKVDKVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
            + PE  +NKI F+NLTPL+P +   +E +    ++I+ R+ID++APIGKGQR L+VA P
Sbjct: 121 GEPPENAKNKILFENLTPLFPTQHMTLERDIRAEENITGRIIDIVAPIGKGQRGLLVASP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           ++GKT++LQ+IAHSI  N+P+  LIVLLIDERPEEVT+M R+V+GEV++STFDE A RHV
Sbjct: 181 KSGKTVMLQHIAHSIASNNPDAILIVLLIDERPEEVTEMSRTVRGEVVASTFDEPATRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMV+ KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANALQRPKRF
Sbjct: 241 QVAEMVLEKAKRLVEHKKDVVILLDSITRLARAYNTVIPSSGKVLTGGVDANALQRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TALVDTGSRMD+VI+EEFKGTGN EI L+R++A+KRI+PA+++
Sbjct: 301 FGAARNVEEGGSLTIIATALVDTGSRMDDVIYEEFKGTGNMEIHLDRRMAEKRIYPAINV 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            +SGTRKE+LL+++  LQ++++LR+++  M+  +A+EFL+DK+K TK+N +FF SM +
Sbjct: 361 NRSGTRKEELLIKQDLLQRIWVLRKLLYPMDELEAMEFLLDKVKATKNNAEFFDSMKR 418


>gi|317484842|ref|ZP_07943734.1| transcription termination factor Rho [Bilophila wadsworthia 3_1_6]
 gi|316923888|gb|EFV45082.1| transcription termination factor Rho [Bilophila wadsworthia 3_1_6]
          Length = 432

 Score =  558 bits (1438), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 275/421 (65%), Positives = 344/421 (81%), Gaps = 4/421 (0%)

Query: 2   SEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVL 61
           + M L ELKN S + L+  AE  EIENA+ MRKQEL+F++L+  + R   I G+GV+E+L
Sbjct: 15  ATMSLTELKNMSMSVLMELAEKYEIENASSMRKQELIFAMLQACASRSGAIYGDGVLEIL 74

Query: 62  QDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNA 121
            DG+GFLRSP ++Y+ GPDDIYVSPSQI+ F L+ GD V G IR P+EGERYFALLKV  
Sbjct: 75  PDGYGFLRSPLSSYMPGPDDIYVSPSQIRRFYLRKGDVVSGQIRPPKEGERYFALLKVKE 134

Query: 122 INFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVA 181
           I F+ PE  R+ + FDNLTP+YPD++  ME  N E K++S RVIDL++PIG+GQR +IVA
Sbjct: 135 IGFEPPENARHVVLFDNLTPIYPDRKLIME--NGE-KNLSCRVIDLMSPIGRGQRGVIVA 191

Query: 182 PPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQ-GEVISSTFDESAA 240
           PPRTGKTILLQ+IA+SI  NHPE YLIVLLIDERPEEVTDM+R+V+  EVISSTFDE   
Sbjct: 192 PPRTGKTILLQSIANSINANHPEVYLIVLLIDERPEEVTDMERTVKNAEVISSTFDEPPQ 251

Query: 241 RHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRP 300
           RHVQV EMV+ KAK LVE   DVVILLDSITRL RAYN + PSSG++L+GG+DANALQRP
Sbjct: 252 RHVQVCEMVLEKAKRLVERKRDVVILLDSITRLGRAYNAVTPSSGRVLSGGLDANALQRP 311

Query: 301 KRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPA 360
           KRFFGAARNI+ GGSLTII TAL+DTGSRMDEVIFEEFKGTGN EI L+R +A+KR+FPA
Sbjct: 312 KRFFGAARNIEGGGSLTIIATALIDTGSRMDEVIFEEFKGTGNMEIYLDRHLAEKRVFPA 371

Query: 361 MDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           +DI ++GTRKEDLL+    L++V++LR+I++ M+S D++EFL+DK++ TK N++F  +M+
Sbjct: 372 IDINRTGTRKEDLLLSDDVLKRVWILRKILAPMSSIDSMEFLLDKMRGTKSNEEFINAMS 431

Query: 421 K 421
           K
Sbjct: 432 K 432


>gi|242280391|ref|YP_002992520.1| transcription termination factor Rho [Desulfovibrio salexigens DSM
           2638]
 gi|242123285|gb|ACS80981.1| transcription termination factor Rho [Desulfovibrio salexigens DSM
           2638]
          Length = 424

 Score =  558 bits (1438), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 270/421 (64%), Positives = 342/421 (81%), Gaps = 3/421 (0%)

Query: 1   MSEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEV 60
           +  + L ELK K  + L+  A   ++EN + MRKQEL+F++L+  + ++ +I GEGV+EV
Sbjct: 7   IQNLNLTELKQKKMSDLMDLAAKFKVENPSGMRKQELIFALLQGCAAQNGQIYGEGVLEV 66

Query: 61  LQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVN 120
           L DGFGFLRSP  +Y+ GPDDIYVSPSQI+ F L+ GD + G IR P+EGERYFALL+VN
Sbjct: 67  LPDGFGFLRSPTYSYMPGPDDIYVSPSQIRRFGLRKGDIISGQIRPPKEGERYFALLRVN 126

Query: 121 AINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIV 180
            I  + PE  RN + FDNLTP+YPD RF ME N P+N   SSRVID+++PIG+GQR+L+V
Sbjct: 127 EIGLEPPEHSRNLVLFDNLTPVYPDNRFKME-NGPKN--FSSRVIDILSPIGRGQRALLV 183

Query: 181 APPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAA 240
           APPRTGKT++LQNIA+SI  NHP+  LIVLLIDERPEEVTDM R+V+ EV+SSTFDE   
Sbjct: 184 APPRTGKTMMLQNIANSINANHPDVDLIVLLIDERPEEVTDMARTVKAEVVSSTFDEPPQ 243

Query: 241 RHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRP 300
           RHVQV EMV+ KAK LVE   DVVILLDSITRL RAYN + PSSG++L+GG+DANA+QRP
Sbjct: 244 RHVQVTEMVLEKAKRLVERKRDVVILLDSITRLGRAYNAVTPSSGRVLSGGLDANAMQRP 303

Query: 301 KRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPA 360
           KRFFGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGN ++ L+RK+A+KR+FPA
Sbjct: 304 KRFFGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNMDLYLDRKLAEKRVFPA 363

Query: 361 MDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           +DI +SGTRKE+LL++   L KV++LR++++ MNS D++EFL+DK+K TK+N +FF  M 
Sbjct: 364 IDINRSGTRKEELLLDDGVLNKVWILRKLLAPMNSIDSMEFLLDKMKGTKNNDEFFDMMG 423

Query: 421 K 421
           K
Sbjct: 424 K 424


>gi|212633327|ref|YP_002309852.1| transcription termination factor Rho [Shewanella piezotolerans WP3]
 gi|212554811|gb|ACJ27265.1| Transcription termination factor Rho [Shewanella piezotolerans WP3]
          Length = 421

 Score =  558 bits (1437), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 268/418 (64%), Positives = 337/418 (80%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK+ S + L+  A+ +++EN    RKQ+++FSILK  +    +I G GV+E+LQD
Sbjct: 1   MNLSELKDTSISDLVQLAQDMKLENMARARKQDIIFSILKAHAKSGEDIFGGGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS D +YLAGPDDIYVSPSQI+ F+++TGDT+ G IR P++GERYFALLKV  +N
Sbjct: 61  GFGFLRSSDGSYLAGPDDIYVSPSQIRRFNMRTGDTIFGKIRPPKDGERYFALLKVTEVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           FD PE  RNKI F+NLTPL+ ++R  ME  N   +DI+SR++DL +P+GKGQR LIVAPP
Sbjct: 121 FDRPENSRNKILFENLTPLHAEERLRMERGNGSTEDITSRILDLCSPVGKGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKT+LLQN+A SI  N+P+  L+VLLIDERPEEVT+MQR V+GEVI+STFDE A+RHV
Sbjct: 181 KAGKTLLLQNMAQSITYNNPDVVLMVLLIDERPEEVTEMQRMVKGEVIASTFDEPASRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDANAL RPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVIPSSGKVLTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+ GGSLTII TALVDTGS+MDEVI+EEFKGTGN E+ L RK A+KR+FPA+D 
Sbjct: 301 FGAARNIEHGGSLTIIATALVDTGSKMDEVIYEEFKGTGNQELHLSRKAAEKRVFPAIDF 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            +SGTR+E+ L    +LQK+++LR+I++ M+    +EFLIDKL  TK N +FF +M +
Sbjct: 361 NRSGTRREEKLTTPDELQKMWILRKILNPMDEVTGMEFLIDKLAMTKTNDEFFTAMKR 418


>gi|167856500|ref|ZP_02479214.1| transcription termination factor Rho [Haemophilus parasuis 29755]
 gi|167852380|gb|EDS23680.1| transcription termination factor Rho [Haemophilus parasuis 29755]
          Length = 420

 Score =  557 bits (1436), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 273/419 (65%), Positives = 338/419 (80%), Gaps = 1/419 (0%)

Query: 4   MKLQELKNKSPTKLLAFAE-SLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQ 62
           M L ELKN   ++L+   E  + +EN   +RKQ+++F+ILK  +    +I G+GV+E+L 
Sbjct: 1   MHLTELKNTPVSELVRIGEEQMGLENLARLRKQDIIFAILKQHAKSGEDIFGQGVLEILP 60

Query: 63  DGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAI 122
           DGFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGD +EG IR P+EGERYFALLKV+ +
Sbjct: 61  DGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLQTGDKIEGKIRPPKEGERYFALLKVDLV 120

Query: 123 NFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAP 182
           N D PE  R+KI F+NLTPL+ + R  ME  N   +D+++R++DL +PIGKGQR LIVAP
Sbjct: 121 NDDKPEVSRSKILFENLTPLHANSRLRMERGNGSKEDLTARILDLASPIGKGQRGLIVAP 180

Query: 183 PRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARH 242
           P+ GKT+LLQNIA SI  N+PEC LIVLLIDERPEEVT+MQRSV+GEVI+STFDE A RH
Sbjct: 181 PKAGKTVLLQNIAQSITHNYPECELIVLLIDERPEEVTEMQRSVKGEVIASTFDEPATRH 240

Query: 243 VQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKR 302
           VQVAEMVI KAK LVE+  DVVILLDSITRL RAYN + P+SGKIL+GGVDANAL RPKR
Sbjct: 241 VQVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVTPASGKILSGGVDANALHRPKR 300

Query: 303 FFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMD 362
           FFGAARN++EGGSLTII TALVDTGS+MDEVIFEEFKGTGN E+ L RKIA++R+FPA+D
Sbjct: 301 FFGAARNVEEGGSLTIIATALVDTGSKMDEVIFEEFKGTGNMELHLSRKIAERRVFPAID 360

Query: 363 IIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
             +SGTRKEDLL    +LQK+++LR+I++ M   +A+EFLIDKL   K N +FF  M +
Sbjct: 361 FNRSGTRKEDLLTSPDELQKMWILRKILNPMGEVEAMEFLIDKLMVAKTNDEFFEIMKR 419


>gi|53719129|ref|YP_108115.1| transcription termination factor Rho [Burkholderia pseudomallei
           K96243]
 gi|76811459|ref|YP_333770.1| transcription termination factor Rho [Burkholderia pseudomallei
           1710b]
 gi|126439336|ref|YP_001059245.1| transcription termination factor Rho [Burkholderia pseudomallei
           668]
 gi|126452370|ref|YP_001066512.1| transcription termination factor Rho [Burkholderia pseudomallei
           1106a]
 gi|134277618|ref|ZP_01764333.1| transcription termination factor Rho [Burkholderia pseudomallei
           305]
 gi|167719242|ref|ZP_02402478.1| transcription termination factor Rho [Burkholderia pseudomallei
           DM98]
 gi|167738239|ref|ZP_02411013.1| transcription termination factor Rho [Burkholderia pseudomallei 14]
 gi|167815429|ref|ZP_02447109.1| transcription termination factor Rho [Burkholderia pseudomallei 91]
 gi|167823839|ref|ZP_02455310.1| transcription termination factor Rho [Burkholderia pseudomallei 9]
 gi|167845380|ref|ZP_02470888.1| transcription termination factor Rho [Burkholderia pseudomallei
           B7210]
 gi|167893923|ref|ZP_02481325.1| transcription termination factor Rho [Burkholderia pseudomallei
           7894]
 gi|167902375|ref|ZP_02489580.1| transcription termination factor Rho [Burkholderia pseudomallei
           NCTC 13177]
 gi|167910615|ref|ZP_02497706.1| transcription termination factor Rho [Burkholderia pseudomallei
           112]
 gi|167918640|ref|ZP_02505731.1| transcription termination factor Rho [Burkholderia pseudomallei
           BCC215]
 gi|217421916|ref|ZP_03453420.1| transcription termination factor Rho [Burkholderia pseudomallei
           576]
 gi|226197357|ref|ZP_03792934.1| transcription termination factor Rho [Burkholderia pseudomallei
           Pakistan 9]
 gi|237812569|ref|YP_002897020.1| transcription termination factor Rho [Burkholderia pseudomallei
           MSHR346]
 gi|242316164|ref|ZP_04815180.1| transcription termination factor Rho [Burkholderia pseudomallei
           1106b]
 gi|254179531|ref|ZP_04886130.1| transcription termination factor Rho [Burkholderia pseudomallei
           1655]
 gi|254189077|ref|ZP_04895588.1| transcription termination factor Rho [Burkholderia pseudomallei
           Pasteur 52237]
 gi|254197202|ref|ZP_04903624.1| transcription termination factor Rho [Burkholderia pseudomallei
           S13]
 gi|254261910|ref|ZP_04952964.1| transcription termination factor Rho [Burkholderia pseudomallei
           1710a]
 gi|254297410|ref|ZP_04964863.1| transcription termination factor Rho [Burkholderia pseudomallei
           406e]
 gi|52209543|emb|CAH35496.1| transcription termination factor rho [Burkholderia pseudomallei
           K96243]
 gi|76580912|gb|ABA50387.1| transcription termination factor Rho [Burkholderia pseudomallei
           1710b]
 gi|126218829|gb|ABN82335.1| transcription termination factor Rho [Burkholderia pseudomallei
           668]
 gi|126226012|gb|ABN89552.1| transcription termination factor Rho [Burkholderia pseudomallei
           1106a]
 gi|134251268|gb|EBA51347.1| transcription termination factor Rho [Burkholderia pseudomallei
           305]
 gi|157807781|gb|EDO84951.1| transcription termination factor Rho [Burkholderia pseudomallei
           406e]
 gi|157936756|gb|EDO92426.1| transcription termination factor Rho [Burkholderia pseudomallei
           Pasteur 52237]
 gi|169653943|gb|EDS86636.1| transcription termination factor Rho [Burkholderia pseudomallei
           S13]
 gi|184210071|gb|EDU07114.1| transcription termination factor Rho [Burkholderia pseudomallei
           1655]
 gi|217395658|gb|EEC35676.1| transcription termination factor Rho [Burkholderia pseudomallei
           576]
 gi|225930736|gb|EEH26746.1| transcription termination factor Rho [Burkholderia pseudomallei
           Pakistan 9]
 gi|237505106|gb|ACQ97424.1| transcription termination factor Rho [Burkholderia pseudomallei
           MSHR346]
 gi|242139403|gb|EES25805.1| transcription termination factor Rho [Burkholderia pseudomallei
           1106b]
 gi|254220599|gb|EET09983.1| transcription termination factor Rho [Burkholderia pseudomallei
           1710a]
          Length = 420

 Score =  557 bits (1436), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 262/418 (62%), Positives = 346/418 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK+   ++L+  A  LEIENAN +RKQELMF+ILK  +     I G+G +EVL D
Sbjct: 1   MHLSELKSLHVSELIEMANGLEIENANRLRKQELMFAILKKRAKTGETIFGDGTLEVLPD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSP+ +YLA  DDIY+SPSQI+ F+L TGDT+EG +R P++GERYFAL+KV+ +N
Sbjct: 61  GFGFLRSPEMSYLASTDDIYISPSQIRRFNLHTGDTIEGEVRTPKDGERYFALVKVDKVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
              PE  ++KI F+NLTPL+P+K  ++E      ++++ R+ID+IAPIGKGQR L+VA P
Sbjct: 121 GQPPEASKHKIMFENLTPLHPNKPLSLEREMRGEENVTGRIIDMIAPIGKGQRGLLVASP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           ++GKT++LQ+IAH+IK+NHP+  L VLLIDERPEEVT+MQRSV GEVI+STFDE A RHV
Sbjct: 181 KSGKTVMLQHIAHAIKQNHPDVILFVLLIDERPEEVTEMQRSVAGEVIASTFDEPATRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE   DVVILLDSITRL RAYN ++P+SGK+LTGGVDANALQRPKRF
Sbjct: 241 QVAEMVIEKAKRLVEMKHDVVILLDSITRLARAYNTVIPASGKVLTGGVDANALQRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTIIGTAL++TGSRMD+VI+EEFKGTGN E+ LER++A+KR++P++++
Sbjct: 301 FGAARNIEEGGSLTIIGTALIETGSRMDDVIYEEFKGTGNMEVHLERRLAEKRVYPSINL 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            KSGTR+E++L++ + LQK+++LR+ +  M+  +A+EFL+DK++QTK+N +FF  M +
Sbjct: 361 NKSGTRREEMLIKPEILQKIWVLRKFIHDMDEVEAMEFLLDKIRQTKNNAEFFDLMRR 418


>gi|78066599|ref|YP_369368.1| transcription termination factor Rho [Burkholderia sp. 383]
 gi|107028992|ref|YP_626087.1| transcription termination factor Rho [Burkholderia cenocepacia AU
           1054]
 gi|116689850|ref|YP_835473.1| transcription termination factor Rho [Burkholderia cenocepacia
           HI2424]
 gi|134295860|ref|YP_001119595.1| transcription termination factor Rho [Burkholderia vietnamiensis
           G4]
 gi|167587028|ref|ZP_02379416.1| transcription termination factor Rho [Burkholderia ubonensis Bu]
 gi|170733189|ref|YP_001765136.1| transcription termination factor Rho [Burkholderia cenocepacia
           MC0-3]
 gi|206560265|ref|YP_002231029.1| transcription termination factor Rho [Burkholderia cenocepacia
           J2315]
 gi|254248055|ref|ZP_04941376.1| Transcription termination factor Rho [Burkholderia cenocepacia
           PC184]
 gi|77967344|gb|ABB08724.1| transcription termination factor Rho [Burkholderia sp. 383]
 gi|105898156|gb|ABF81114.1| transcription termination factor Rho [Burkholderia cenocepacia AU
           1054]
 gi|116647939|gb|ABK08580.1| transcription termination factor Rho [Burkholderia cenocepacia
           HI2424]
 gi|124872831|gb|EAY64547.1| Transcription termination factor Rho [Burkholderia cenocepacia
           PC184]
 gi|134139017|gb|ABO54760.1| transcription termination factor Rho [Burkholderia vietnamiensis
           G4]
 gi|169816431|gb|ACA91014.1| transcription termination factor Rho [Burkholderia cenocepacia
           MC0-3]
 gi|198036306|emb|CAR52202.1| transcription termination factor rho [Burkholderia cenocepacia
           J2315]
 gi|325522358|gb|EGD00960.1| transcription termination factor Rho [Burkholderia sp. TJI49]
          Length = 420

 Score =  557 bits (1435), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 262/418 (62%), Positives = 345/418 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK+   ++L+  A  LEIENAN +RKQELMF+ILK  +     I G+G +EVL D
Sbjct: 1   MHLSELKSLHVSELIEMANGLEIENANRLRKQELMFAILKKRAKTGETIFGDGTLEVLPD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSP+ +YLA  DDIY+SPSQI+ F+L TGDT+EG +R P++GERYFAL+KV+ +N
Sbjct: 61  GFGFLRSPEMSYLASTDDIYISPSQIRRFNLHTGDTIEGEVRTPKDGERYFALVKVDKVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
              PE  ++KI F+NLTPL+P+K  ++E      ++++ R+ID+IAPIGKGQR L+VA P
Sbjct: 121 GQPPEASKHKIMFENLTPLHPNKPLSLEREMRGEENVTGRIIDMIAPIGKGQRGLLVASP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           ++GKT++LQ+IAH+IK+NHP+  L VLLIDERPEEVT+MQRSV GEVI+STFDE A RHV
Sbjct: 181 KSGKTVMLQHIAHAIKQNHPDVILFVLLIDERPEEVTEMQRSVAGEVIASTFDEPATRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE   DVVILLDSITRL RAYN ++P+SGK+LTGGVDANALQRPKRF
Sbjct: 241 QVAEMVIEKAKRLVEMKHDVVILLDSITRLARAYNTVIPASGKVLTGGVDANALQRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTIIGTAL++TGSRMD+VI+EEFKGTGN E+ LER++A+KR++P++++
Sbjct: 301 FGAARNIEEGGSLTIIGTALIETGSRMDDVIYEEFKGTGNMEVHLERRLAEKRVYPSINL 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            KSGTR+E++L++ + LQK+++LR+ +  M+  +A+EFL+DK++QTK N +FF  M +
Sbjct: 361 NKSGTRREEMLIKPEILQKIWVLRKFIHDMDEVEAMEFLLDKIRQTKSNSEFFDLMRR 418


>gi|94264417|ref|ZP_01288207.1| Transcription termination factor Rho [delta proteobacterium MLMS-1]
 gi|93455174|gb|EAT05392.1| Transcription termination factor Rho [delta proteobacterium MLMS-1]
          Length = 423

 Score =  557 bits (1435), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 271/420 (64%), Positives = 346/420 (82%), Gaps = 7/420 (1%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILK---VLSGRDVEIIGEGVIEV 60
           M L ELK K   +L   A+ L IE    MRKQEL+F+I++     +G++ +  G GV+EV
Sbjct: 1   MNLGELKRKKIAELTKIAKDLNIEGYTAMRKQELIFAIIQKQTTSNGKNGDNYGGGVLEV 60

Query: 61  LQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVN 120
           L DGFGFLR+PD NYL GPDDIYVSPSQI+  +L+TGDT+EG +RAP++ ERYFALLKV+
Sbjct: 61  LPDGFGFLRAPDYNYLPGPDDIYVSPSQIRRLNLRTGDTIEGPVRAPKDSERYFALLKVD 120

Query: 121 AINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIV 180
            +NFD P++ R+K  F NLTPL+P++R N+E   P++   S+R++D++APIGKGQR LIV
Sbjct: 121 KVNFDPPDKTRDKTLFTNLTPLHPNERINLE-RLPDH--YSTRILDMMAPIGKGQRGLIV 177

Query: 181 APPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQ-GEVISSTFDESA 239
           APPRTGKT+L+ +IA+SI +NHP+  LIVLLIDERPEEVTDM R V+  EVISSTFDE  
Sbjct: 178 APPRTGKTVLITDIANSITRNHPDTILIVLLIDERPEEVTDMSRGVENAEVISSTFDEPP 237

Query: 240 ARHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQR 299
            RH+QVAEMV+ KA+ LVE+  DVVILLDSITRL RAYN ++P SGKIL+GGVD+NAL R
Sbjct: 238 QRHIQVAEMVLDKARRLVEHKKDVVILLDSITRLARAYNTVVPPSGKILSGGVDSNALHR 297

Query: 300 PKRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFP 359
           PKRFFGAARNI+EGGSLTII +AL++TGSRMD+VIFEEFKGTGN EIVL+RK+AD+RI+P
Sbjct: 298 PKRFFGAARNIEEGGSLTIIASALIETGSRMDDVIFEEFKGTGNMEIVLDRKLADRRIYP 357

Query: 360 AMDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSM 419
           AMDI KSGTRKEDLL+  +++ K+++LR++++SMN  DA+EFL+DKLK+TK N++FF SM
Sbjct: 358 AMDITKSGTRKEDLLLSAEEMNKIWILRKLLASMNPVDAMEFLLDKLKRTKSNEEFFASM 417


>gi|304569702|ref|YP_010790.2| transcription termination factor Rho [Desulfovibrio vulgaris str.
           Hildenborough]
          Length = 429

 Score =  557 bits (1435), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 272/421 (64%), Positives = 342/421 (81%), Gaps = 4/421 (0%)

Query: 2   SEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVL 61
           S M L ELK KS  +L+  AE  ++ENA+ MRKQEL+F++L+  + ++  I G+GV+E+L
Sbjct: 12  SAMNLSELKIKSMQELMELAEQFKVENASGMRKQELIFALLQACASQNGAIYGDGVLEIL 71

Query: 62  QDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNA 121
            DGFGFLRSP  +Y+ GPDDIYVSPSQI+ F+L+ GD V G IR P+EGERYFALLKV  
Sbjct: 72  PDGFGFLRSPLCSYMPGPDDIYVSPSQIRRFALRKGDVVSGQIRPPKEGERYFALLKVTE 131

Query: 122 INFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVA 181
           I F+ PE  +N + FDNLTP+YPD++F ME  +   K+ SSR+ID++APIG GQR LIVA
Sbjct: 132 IGFEPPENAKNLVLFDNLTPIYPDRQFIMENGD---KNYSSRIIDIMAPIGCGQRGLIVA 188

Query: 182 PPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQ-GEVISSTFDESAA 240
           PPRTGKT+LLQ IA+SI  N P+ YLIVLLIDERPEEVTDM+R+V+  EV+SSTFDE   
Sbjct: 189 PPRTGKTMLLQTIANSINANSPDTYLIVLLIDERPEEVTDMERTVKNAEVVSSTFDEPPQ 248

Query: 241 RHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRP 300
           RHVQV EMV+ KAK LVE   DVVILLDSITRL RAYN + PSSG++L+GG+DANALQRP
Sbjct: 249 RHVQVCEMVLEKAKRLVERKRDVVILLDSITRLGRAYNAVTPSSGRVLSGGLDANALQRP 308

Query: 301 KRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPA 360
           KRFFGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGN EI L+R +++KR+FPA
Sbjct: 309 KRFFGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNMEIYLDRHLSEKRVFPA 368

Query: 361 MDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           +DI ++GTRKEDLL+  + L +V++LR+I++ M+S D++EFL+DK++ TK N+DF   MN
Sbjct: 369 IDINRTGTRKEDLLLSDEVLNRVWILRKILAPMSSIDSMEFLLDKMRGTKSNRDFMNCMN 428

Query: 421 K 421
           K
Sbjct: 429 K 429


>gi|325266650|ref|ZP_08133327.1| transcription termination factor Rho [Kingella denitrificans ATCC
           33394]
 gi|324982093|gb|EGC17728.1| transcription termination factor Rho [Kingella denitrificans ATCC
           33394]
          Length = 451

 Score =  557 bits (1435), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 265/416 (63%), Positives = 342/416 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M + EL+ K  T+LLA AE + IENAN +RKQ+L+F+I++ L     E I  G +E L D
Sbjct: 1   MHVSELQTKHITELLAQAEQMGIENANRLRKQDLVFTIVRKLMENGQEFICSGTLETLPD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           G+GFLRS   +YLA PDDIYVSP QI+ F+L TGDT+EG++R P+  E+YFAL++++++N
Sbjct: 61  GYGFLRSAATSYLACPDDIYVSPHQIRRFNLHTGDTIEGTVRVPKNDEKYFALVRLDSVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
            D PE+ R+KI F+NLTPL+P+K+  +E +N   ++I+ R+IDLI+PIG GQR+L+VAPP
Sbjct: 121 GDHPEKCRHKILFENLTPLFPEKQLKLEQDNLSAENITGRIIDLISPIGLGQRALLVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           +TGKT++LQNIAH+I  N+P+  LIVLLIDERPEEVT+M RSV+GEV++STFDE A RHV
Sbjct: 181 KTGKTVMLQNIAHAITANYPDVELIVLLIDERPEEVTEMTRSVRGEVVASTFDEPAQRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK +VE+  DVVILLDSITRL RAYN ++P+SGKILTGGVDANAL RPKRF
Sbjct: 241 QVAEMVIEKAKRMVEHKKDVVILLDSITRLARAYNTVVPTSGKILTGGVDANALHRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN +EGGSLTII TALVDTGSRMD+VIFEEFKGTGN E+ LER++A+KR+FPA++I
Sbjct: 301 FGAARNTEEGGSLTIIATALVDTGSRMDDVIFEEFKGTGNMELNLERRLAEKRVFPAINI 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSM 419
            KSGTR+E+LLV    LQK++ LRR++  M+  +A EFL+DK+K+TK+N DFF SM
Sbjct: 361 NKSGTRREELLVPADQLQKMWALRRVIHPMDDIEAAEFLLDKIKKTKNNDDFFDSM 416


>gi|186475714|ref|YP_001857184.1| transcription termination factor Rho [Burkholderia phymatum STM815]
 gi|184192173|gb|ACC70138.1| transcription termination factor Rho [Burkholderia phymatum STM815]
          Length = 420

 Score =  557 bits (1435), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 263/418 (62%), Positives = 345/418 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK    ++L+  A  LEIE+AN +RKQELMF+ILK  +     I G+G +EVL D
Sbjct: 1   MHLSELKTLHVSQLIEMANGLEIESANRLRKQELMFAILKKRAKTGETIFGDGTLEVLPD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSP+ +YLA  DDIY+SPSQI+ F+L TGDT+EG +R P++GERYFAL+KV+ +N
Sbjct: 61  GFGFLRSPETSYLASTDDIYISPSQIRRFNLHTGDTIEGEVRTPKDGERYFALVKVDKVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
              PE  ++KI F+NLTPL+P+K   +E      ++++ R+ID+IAPIGKGQR L+VA P
Sbjct: 121 GQPPEASKHKIMFENLTPLHPNKVLLLEREMRGEENVTGRIIDMIAPIGKGQRGLLVASP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           ++GKT++LQ+IAH+IK+NHP+  L VLLIDERPEEVT+MQRSV GEVI+STFDE AARHV
Sbjct: 181 KSGKTVMLQHIAHAIKQNHPDVILFVLLIDERPEEVTEMQRSVAGEVIASTFDEPAARHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE   DVVILLDSITRL RAYN ++P+SGK+LTGGVDANALQRPKRF
Sbjct: 241 QVAEMVIEKAKRLVEMKNDVVILLDSITRLARAYNTVVPASGKVLTGGVDANALQRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTIIGTAL++TGSRMD+VI+EEFKGTGN E+ LER++A+KR++P++++
Sbjct: 301 FGAARNIEEGGSLTIIGTALIETGSRMDDVIYEEFKGTGNMEVHLERRLAEKRVYPSINL 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            KSGTR+E+LL++ + LQK+++LR+ +  M+  +A+EFL+DK++QTK+N +FF  M +
Sbjct: 361 NKSGTRREELLIKPEILQKIWVLRKFIHDMDEVEAMEFLLDKIRQTKNNAEFFDMMRR 418


>gi|171059487|ref|YP_001791836.1| transcription termination factor Rho [Leptothrix cholodnii SP-6]
 gi|170776932|gb|ACB35071.1| transcription termination factor Rho [Leptothrix cholodnii SP-6]
          Length = 420

 Score =  557 bits (1435), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 264/418 (63%), Positives = 350/418 (83%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK +  + L+  AE+LEIENA+ +RKQELMF+I+K  + +  +I G+GV+EVL D
Sbjct: 1   MHLSELKAQHISALVQMAETLEIENASRLRKQELMFAIMKKRARQGEQIFGDGVLEVLPD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS DA++LA  DDIY+SPSQI+ F+L TGD +EG +R P++GERYFAL+KV+ +N
Sbjct: 61  GFGFLRSLDASFLASTDDIYLSPSQIRRFNLHTGDMIEGEVRVPKDGERYFALVKVDRVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
              PE  +NKI F+NLTPL+P ++F +E +    ++I+SR+IDLIAPIGKGQR+L+VAPP
Sbjct: 121 ELTPEESKNKIMFENLTPLFPKEQFRLERDVKNEENITSRIIDLIAPIGKGQRALLVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           ++GKT+++Q+ AH++  NHP+ +LIVLL+DERPEEVT+MQR+V+GEVISSTFDE AARHV
Sbjct: 181 KSGKTVMMQHFAHALIANHPDVHLIVLLVDERPEEVTEMQRTVRGEVISSTFDEPAARHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI +AK LVE   DVVILLDSITRL RAYN ++PSSGK+LTGGVDA ALQRPKRF
Sbjct: 241 QVAEMVIERAKRLVELRKDVVILLDSITRLARAYNNVLPSSGKVLTGGVDAGALQRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTIIGTAL+DTGSRMDEVI+EEFKGTGN EI L+R++A+KR++P++ +
Sbjct: 301 FGAARNVEEGGSLTIIGTALIDTGSRMDEVIYEEFKGTGNCEIHLDRRMAEKRVYPSILL 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            KSGTR+E+LL++ + LQK ++LR+++  M+  +A+EF++DK+K TK N DFF  M +
Sbjct: 361 NKSGTRREELLLKPEILQKTWILRKLLYPMDEIEAMEFILDKMKATKSNIDFFDLMRR 418


>gi|170718541|ref|YP_001783395.1| transcription termination factor Rho [Haemophilus somnus 2336]
 gi|168826670|gb|ACA32041.1| transcription termination factor Rho [Haemophilus somnus 2336]
          Length = 420

 Score =  557 bits (1435), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 274/419 (65%), Positives = 338/419 (80%), Gaps = 1/419 (0%)

Query: 4   MKLQELKNKSPTKLLAFAE-SLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQ 62
           M L ELKNK  ++L+   E  + +EN   +RKQ+++F+ILK  +    +I G G++E+L 
Sbjct: 1   MHLTELKNKPVSELVELGEKQMGLENLARLRKQDIIFAILKQHAKSGEDIFGGGILEILP 60

Query: 63  DGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAI 122
           DGFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGD +EG IR P+EGERYFALLKV+ +
Sbjct: 61  DGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLQTGDKIEGKIRPPKEGERYFALLKVDRV 120

Query: 123 NFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAP 182
           N D PE  R+KI F+NLTPL+ + R  ME  N   +D+++R++DL +PIGKGQR LIVAP
Sbjct: 121 NDDKPEVSRSKILFENLTPLHANSRLRMERGNGATEDLTARILDLASPIGKGQRGLIVAP 180

Query: 183 PRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARH 242
           P+ GKT+LLQNIA SI  N+PEC LIVLLIDERPEEVT+MQRSV+GEVI+STFDE AARH
Sbjct: 181 PKAGKTMLLQNIAQSIIHNYPECELIVLLIDERPEEVTEMQRSVKGEVIASTFDEPAARH 240

Query: 243 VQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKR 302
           VQVAEMVI KAK  VE+  DVVILLDSITRL RAYN + P SGKIL+GGVDANAL RPKR
Sbjct: 241 VQVAEMVIEKAKRSVEHKKDVVILLDSITRLARAYNTVTPPSGKILSGGVDANALHRPKR 300

Query: 303 FFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMD 362
           FFGAARN++EGGSLTII TALVDTGS+MDEVIFEEFKGTGN E+ L RKIA+KR+FPA+D
Sbjct: 301 FFGAARNVEEGGSLTIIATALVDTGSKMDEVIFEEFKGTGNMELHLSRKIAEKRVFPAID 360

Query: 363 IIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
             +SGTRKEDLL    +LQK+++LR+I++ M   +A+EFLIDKL   K N++FF  M +
Sbjct: 361 FNRSGTRKEDLLTTPDELQKMWILRKILNPMGEIEAMEFLIDKLMMAKTNEEFFEVMKR 419


>gi|120602606|ref|YP_967006.1| transcription termination factor Rho [Desulfovibrio vulgaris DP4]
 gi|120562835|gb|ABM28579.1| transcription termination factor Rho [Desulfovibrio vulgaris DP4]
          Length = 449

 Score =  557 bits (1435), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 272/421 (64%), Positives = 342/421 (81%), Gaps = 4/421 (0%)

Query: 2   SEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVL 61
           S M L ELK KS  +L+  AE  ++ENA+ MRKQEL+F++L+  + ++  I G+GV+E+L
Sbjct: 32  SAMNLSELKIKSMQELMELAEQFKVENASGMRKQELIFALLQACASQNGAIYGDGVLEIL 91

Query: 62  QDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNA 121
            DGFGFLRSP  +Y+ GPDDIYVSPSQI+ F+L+ GD V G IR P+EGERYFALLKV  
Sbjct: 92  PDGFGFLRSPLCSYMPGPDDIYVSPSQIRRFALRKGDVVSGQIRPPKEGERYFALLKVTE 151

Query: 122 INFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVA 181
           I F+ PE  +N + FDNLTP+YPD++F ME  +   K+ SSR+ID++APIG GQR LIVA
Sbjct: 152 IGFEPPENAKNLVLFDNLTPIYPDRQFIMENGD---KNYSSRIIDIMAPIGCGQRGLIVA 208

Query: 182 PPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQ-GEVISSTFDESAA 240
           PPRTGKT+LLQ IA+SI  N P+ YLIVLLIDERPEEVTDM+R+V+  EV+SSTFDE   
Sbjct: 209 PPRTGKTMLLQTIANSINANSPDTYLIVLLIDERPEEVTDMERTVKNAEVVSSTFDEPPQ 268

Query: 241 RHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRP 300
           RHVQV EMV+ KAK LVE   DVVILLDSITRL RAYN + PSSG++L+GG+DANALQRP
Sbjct: 269 RHVQVCEMVLEKAKRLVERKRDVVILLDSITRLGRAYNAVTPSSGRVLSGGLDANALQRP 328

Query: 301 KRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPA 360
           KRFFGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGN EI L+R +++KR+FPA
Sbjct: 329 KRFFGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNMEIYLDRHLSEKRVFPA 388

Query: 361 MDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           +DI ++GTRKEDLL+  + L +V++LR+I++ M+S D++EFL+DK++ TK N+DF   MN
Sbjct: 389 IDINRTGTRKEDLLLSDEVLNRVWILRKILAPMSSIDSMEFLLDKMRGTKSNRDFMNCMN 448

Query: 421 K 421
           K
Sbjct: 449 K 449


>gi|238027054|ref|YP_002911285.1| transcription termination factor Rho [Burkholderia glumae BGR1]
 gi|237876248|gb|ACR28581.1| Transcription termination factor [Burkholderia glumae BGR1]
          Length = 420

 Score =  557 bits (1435), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 262/418 (62%), Positives = 344/418 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK+   ++L+  A  LEIENAN +RKQELMF+ILK  +     I G+G +EVL D
Sbjct: 1   MHLSELKSLHVSELIEMANGLEIENANRLRKQELMFAILKKRAKTGETIFGDGTLEVLPD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSP+ +YLA  DDIY+SPSQI+ F+L TGDT+EG +R P++GERYFAL+KV+ +N
Sbjct: 61  GFGFLRSPEMSYLASTDDIYISPSQIRRFNLHTGDTIEGEVRTPKDGERYFALVKVDKVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
              PE  ++KI F+NLTPL+P+K  ++E      ++++ R+ID+IAPIGKGQR L+VA P
Sbjct: 121 GQPPEASKHKIMFENLTPLHPNKPLSLEREMRGEENVTGRIIDMIAPIGKGQRGLLVASP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           ++GKT++LQ+IAH+IK+NHP+  L VLLIDERPEEVT+MQRSV GEVI+STFDE A RHV
Sbjct: 181 KSGKTVMLQHIAHAIKQNHPDVILFVLLIDERPEEVTEMQRSVAGEVIASTFDEPATRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE   DVVILLDSITRL RAYN ++P+SGK+LTGGVDANALQRPKRF
Sbjct: 241 QVAEMVIEKAKRLVEMKHDVVILLDSITRLARAYNTVIPASGKVLTGGVDANALQRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTIIGTAL++TGSRMD+VI+EEFKGTGN E+ LER++A+KR++P++++
Sbjct: 301 FGAARNIEEGGSLTIIGTALIETGSRMDDVIYEEFKGTGNMEVHLERRLAEKRVYPSINL 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            KSGTR+E++L++   LQK+++LR+ +  M+  +A+EFL+DK++QTK N +FF  M +
Sbjct: 361 NKSGTRREEMLIKADILQKIWVLRKFIHDMDEVEAMEFLLDKIRQTKSNSEFFDLMRR 418


>gi|83718809|ref|YP_442738.1| transcription termination factor Rho [Burkholderia thailandensis
           E264]
 gi|167581684|ref|ZP_02374558.1| transcription termination factor Rho [Burkholderia thailandensis
           TXDOH]
 gi|167619801|ref|ZP_02388432.1| transcription termination factor Rho [Burkholderia thailandensis
           Bt4]
 gi|167836375|ref|ZP_02463258.1| transcription termination factor Rho [Burkholderia thailandensis
           MSMB43]
 gi|257138950|ref|ZP_05587212.1| transcription termination factor Rho [Burkholderia thailandensis
           E264]
 gi|83652634|gb|ABC36697.1| transcription termination factor Rho [Burkholderia thailandensis
           E264]
          Length = 420

 Score =  557 bits (1435), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 262/418 (62%), Positives = 345/418 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK+   ++L+  A  LEIENAN +RKQELMF+ILK  +     I G+G +EVL D
Sbjct: 1   MHLSELKSLHVSELIEMANGLEIENANRLRKQELMFAILKKRAKTGETIFGDGTLEVLPD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSP+ +YLA  DDIY+SPSQI+ F+L TGDT+EG +R P++GERYFAL+KV+ +N
Sbjct: 61  GFGFLRSPEMSYLASTDDIYISPSQIRRFNLHTGDTIEGEVRTPKDGERYFALVKVDKVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
              PE  ++KI F+NLTPL+P+K   +E      ++++ R+ID+IAPIGKGQR L+VA P
Sbjct: 121 GQPPEASKHKIMFENLTPLHPNKPLWLEREMRGEENVTGRIIDMIAPIGKGQRGLLVASP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           ++GKT++LQ+IAH+IK+NHP+  L VLLIDERPEEVT+MQRSV GEVI+STFDE A RHV
Sbjct: 181 KSGKTVMLQHIAHAIKQNHPDVILFVLLIDERPEEVTEMQRSVAGEVIASTFDEPATRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE   DVVILLDSITRL RAYN ++P+SGK+LTGGVDANALQRPKRF
Sbjct: 241 QVAEMVIEKAKRLVEMKHDVVILLDSITRLARAYNTVIPASGKVLTGGVDANALQRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTIIGTAL++TGSRMD+VI+EEFKGTGN E+ LER++A+KR++P++++
Sbjct: 301 FGAARNIEEGGSLTIIGTALIETGSRMDDVIYEEFKGTGNMEVHLERRLAEKRVYPSINL 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            KSGTR+E++L++ + LQK+++LR+ +  M+  +A+EFL+DK++QTK+N +FF  M +
Sbjct: 361 NKSGTRREEMLIKPEILQKIWVLRKFIHDMDEVEAMEFLLDKIRQTKNNAEFFDLMRR 418


>gi|153003606|ref|YP_001377931.1| transcription termination factor Rho [Anaeromyxobacter sp. Fw109-5]
 gi|152027179|gb|ABS24947.1| transcription termination factor Rho [Anaeromyxobacter sp. Fw109-5]
          Length = 437

 Score =  556 bits (1434), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 271/421 (64%), Positives = 348/421 (82%), Gaps = 10/421 (2%)

Query: 6   LQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSG------RDVEIIGEGVIE 59
           L +LK+    +L   A SLEIE A  M+KQ+L+F+IL+  S        ++E+ GEG +E
Sbjct: 15  LTDLKHMKVAELAKLARSLEIEAAGAMKKQDLIFAILQAQSKVAEEKKEEMEVGGEGTLE 74

Query: 60  VLQDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKV 119
           VL DGFGFLRSPD +YL GPDDIYVSPSQI+ F+L+TGDTV G++R P+EGERYFALLKV
Sbjct: 75  VLPDGFGFLRSPDFSYLPGPDDIYVSPSQIRRFNLRTGDTVRGTVRQPKEGERYFALLKV 134

Query: 120 NAINFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLI 179
           ++IN + PE  + K+ FDNLTPLYP +R ++E ++P   ++++RV+DL +PIGKGQR LI
Sbjct: 135 DSINGEPPEENQTKVLFDNLTPLYPTERLSLE-HDP--NEMTTRVVDLFSPIGKGQRCLI 191

Query: 180 VAPPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESA 239
           V+PPR GKT+LLQN+AH++  NHPEC LIVLLIDERPEEVTDM+R+V+GEV++STFDE A
Sbjct: 192 VSPPRAGKTVLLQNMAHAVTTNHPECTLIVLLIDERPEEVTDMERTVKGEVVASTFDEPA 251

Query: 240 ARHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQR 299
            RHVQVAEMVI KA+ LVE+  DVVILLDSITRL RAYN ++P SGKIL+GGVD+NAL +
Sbjct: 252 TRHVQVAEMVIEKARRLVEHKKDVVILLDSITRLARAYNSVVPPSGKILSGGVDSNALHK 311

Query: 300 PKRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFP 359
           PKRFFGAARNI+EGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVL+RK+ +KRIFP
Sbjct: 312 PKRFFGAARNIEEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLDRKMMEKRIFP 371

Query: 360 AMDIIKSGTRKEDLLVERQDLQKVFMLRR-IVSSMNSSDAIEFLIDKLKQTKDNKDFFYS 418
            MDI KSGTRKE+LL+    L K+++LR+ I++ +++ +A++F++DK +Q K++++FF  
Sbjct: 372 TMDIGKSGTRKEELLLPADWLSKIYILRQTILNGLDNVEAMKFILDKFRQVKNHEEFFKM 431

Query: 419 M 419
           M
Sbjct: 432 M 432


>gi|152977725|ref|YP_001343354.1| transcription termination factor Rho [Actinobacillus succinogenes
           130Z]
 gi|150839448|gb|ABR73419.1| transcription termination factor Rho [Actinobacillus succinogenes
           130Z]
          Length = 420

 Score =  556 bits (1434), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 274/419 (65%), Positives = 336/419 (80%), Gaps = 1/419 (0%)

Query: 4   MKLQELKNKSPTKLLAFAE-SLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQ 62
           M L ELKN   + L+   E  + +EN   +RKQ+++F+ILK  +    +I G GV+E+L 
Sbjct: 1   MHLTELKNTPVSTLVQLGEEQMGLENLARLRKQDIVFAILKQHAKSGEDIFGGGVLEILP 60

Query: 63  DGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAI 122
           DGFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGD VEG IR P+EGERYFALLKV+ +
Sbjct: 61  DGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLQTGDKVEGKIRPPKEGERYFALLKVDQV 120

Query: 123 NFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAP 182
           N D PE  R+KI F+NLTPL+ + R  ME  N   +D+++R++DL +PIGKGQR LIVAP
Sbjct: 121 NDDRPEVSRSKILFENLTPLHANSRLRMERGNGSKEDLTARILDLASPIGKGQRGLIVAP 180

Query: 183 PRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARH 242
           P+ GKT+LLQNIA SI  N+PEC LIVLLIDERPEEVT+MQR+V+GEVI+STFDE AARH
Sbjct: 181 PKAGKTVLLQNIAQSITANYPECELIVLLIDERPEEVTEMQRTVRGEVIASTFDEPAARH 240

Query: 243 VQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKR 302
           VQVAEMVI KAK  VE+  DVVILLDSITRL RAYN + P+SGKIL+GGVDANAL RPKR
Sbjct: 241 VQVAEMVIEKAKRSVEHKKDVVILLDSITRLARAYNTVTPASGKILSGGVDANALHRPKR 300

Query: 303 FFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMD 362
           FFGAARN++EGGSLTII TALVDTGS+MDEVIFEEFKGTGN E+ L RKIA+KR+FPA+D
Sbjct: 301 FFGAARNVEEGGSLTIIATALVDTGSKMDEVIFEEFKGTGNMELHLSRKIAEKRVFPAID 360

Query: 363 IIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
             +SGTRKEDLL    +LQK+++LR+I++ M   +A+EFLIDKL   K N+ FF  M +
Sbjct: 361 FNRSGTRKEDLLTTPDELQKMWILRKILNPMGEVEAMEFLIDKLMVAKTNEAFFEVMKR 419


>gi|115351818|ref|YP_773657.1| transcription termination factor Rho [Burkholderia ambifaria AMMD]
 gi|170701507|ref|ZP_02892460.1| transcription termination factor Rho [Burkholderia ambifaria
           IOP40-10]
 gi|171321032|ref|ZP_02910018.1| transcription termination factor Rho [Burkholderia ambifaria MEX-5]
 gi|172060789|ref|YP_001808441.1| transcription termination factor Rho [Burkholderia ambifaria
           MC40-6]
 gi|115281806|gb|ABI87323.1| transcription termination factor Rho [Burkholderia ambifaria AMMD]
 gi|170133595|gb|EDT01970.1| transcription termination factor Rho [Burkholderia ambifaria
           IOP40-10]
 gi|171093711|gb|EDT38856.1| transcription termination factor Rho [Burkholderia ambifaria MEX-5]
 gi|171993306|gb|ACB64225.1| transcription termination factor Rho [Burkholderia ambifaria
           MC40-6]
          Length = 420

 Score =  556 bits (1434), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 262/418 (62%), Positives = 344/418 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK+   ++L+  A  LEIENAN +RKQELMF+ILK  +     I G+G +EVL D
Sbjct: 1   MHLSELKSLHVSELIEMANGLEIENANRLRKQELMFAILKKRAKTGETIFGDGTLEVLPD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSP+ +YLA  DDIY+SPSQI+ F+L TGDT+EG +R P++GERYFAL+KV+ +N
Sbjct: 61  GFGFLRSPEMSYLASTDDIYISPSQIRRFNLHTGDTIEGEVRTPKDGERYFALVKVDKVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
              PE  ++KI F+NLTPL+P+K   +E      ++++ R+ID+IAPIGKGQR L+VA P
Sbjct: 121 GQPPEASKHKIMFENLTPLHPNKPLALEREMRGEENVTGRIIDMIAPIGKGQRGLLVASP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           ++GKT++LQ+IAH+IK+NHP+  L VLLIDERPEEVT+MQRSV GEVI+STFDE A RHV
Sbjct: 181 KSGKTVMLQHIAHAIKQNHPDVVLFVLLIDERPEEVTEMQRSVAGEVIASTFDEPATRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE   DVVILLDSITRL RAYN ++P+SGK+LTGGVDANALQRPKRF
Sbjct: 241 QVAEMVIEKAKRLVEMKHDVVILLDSITRLARAYNTVIPASGKVLTGGVDANALQRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTIIGTAL++TGSRMD+VI+EEFKGTGN E+ LER++A+KR++P++++
Sbjct: 301 FGAARNIEEGGSLTIIGTALIETGSRMDDVIYEEFKGTGNMEVHLERRLAEKRVYPSINL 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            KSGTR+E++L++ + LQK+++LR+ +  M+  +A+EFL+DK++QTK N +FF  M +
Sbjct: 361 NKSGTRREEMLIKPEILQKIWVLRKFIHDMDEVEAMEFLLDKIRQTKSNSEFFDLMRR 418


>gi|223041774|ref|ZP_03611966.1| transcription termination factor Rho [Actinobacillus minor 202]
 gi|223017425|gb|EEF15844.1| transcription termination factor Rho [Actinobacillus minor 202]
          Length = 420

 Score =  556 bits (1434), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 272/419 (64%), Positives = 338/419 (80%), Gaps = 1/419 (0%)

Query: 4   MKLQELKNKSPTKLLAFAE-SLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQ 62
           M L ELKN   ++L+   E  + +EN   +RKQ+++F+ILK  +    +I G+GV+E+L 
Sbjct: 1   MHLTELKNTPVSELVRIGEEQMGLENLARLRKQDIVFAILKQHAKSGEDIFGQGVLEILP 60

Query: 63  DGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAI 122
           DGFGFLRS D++YLAGPDDIYVSPSQI+ F+L+TGD VEG IR P+EGERYFALLKV+ +
Sbjct: 61  DGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLQTGDKVEGKIRPPKEGERYFALLKVDLV 120

Query: 123 NFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAP 182
           N D PE  R+KI F+NLTPL+ + R  ME  N   +D+++R++DL APIGKGQR+LIVAP
Sbjct: 121 NDDKPEVSRSKILFENLTPLHANSRLRMERGNGSTEDLTARILDLAAPIGKGQRALIVAP 180

Query: 183 PRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARH 242
           P+ GKT+LLQNIA SI  NHPEC LIVLLIDERPEEVT+MQR+V+GEVI+STFDE A RH
Sbjct: 181 PKAGKTVLLQNIAQSITHNHPECELIVLLIDERPEEVTEMQRTVRGEVIASTFDEPATRH 240

Query: 243 VQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKR 302
           VQVAEMVI KAK  VE+  DVVILLDSITRL RAYN + P SGKIL+GGVDANAL RPKR
Sbjct: 241 VQVAEMVIEKAKRSVEHKKDVVILLDSITRLARAYNTVTPVSGKILSGGVDANALHRPKR 300

Query: 303 FFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMD 362
           FFGAARN++EGGSLTII TALVDTGS+MDEVIFEEFKGTGN E+ L RKIA++RIFPA++
Sbjct: 301 FFGAARNVEEGGSLTIIATALVDTGSKMDEVIFEEFKGTGNMELHLSRKIAERRIFPAIE 360

Query: 363 IIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
             +SGTRK+DLL+  ++ QK +MLR++++ M   +AIE+LIDKL   K N++FF  M +
Sbjct: 361 FNRSGTRKDDLLMTPEEHQKTWMLRKVLNPMGEVEAIEWLIDKLGVAKTNEEFFEIMKR 419


>gi|167562526|ref|ZP_02355442.1| transcription termination factor Rho [Burkholderia oklahomensis
           EO147]
 gi|167569712|ref|ZP_02362586.1| transcription termination factor Rho [Burkholderia oklahomensis
           C6786]
          Length = 420

 Score =  556 bits (1433), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 261/418 (62%), Positives = 345/418 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK+   ++L+  A  LEIENAN +RKQELMF+ILK  +     I G+G +EVL D
Sbjct: 1   MHLSELKSLHVSELIEMANGLEIENANRLRKQELMFAILKKRAKTGETIFGDGTLEVLPD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSP+ +YLA  DDIY+SPSQI+ F+L TGDT+EG +R P++GERYFAL+KV+ +N
Sbjct: 61  GFGFLRSPEMSYLASTDDIYISPSQIRRFNLHTGDTIEGEVRTPKDGERYFALVKVDKVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
              PE  ++KI F+NLTPL+P+K   +E      ++++ R++D+IAPIGKGQR L+VA P
Sbjct: 121 GQPPEASKHKIMFENLTPLHPNKPLALEREMRGEENVTGRIVDMIAPIGKGQRGLLVASP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           ++GKT++LQ+IAH+IK+NHP+  L VLLIDERPEEVT+MQRSV GEVI+STFDE A RHV
Sbjct: 181 KSGKTVMLQHIAHAIKQNHPDVILFVLLIDERPEEVTEMQRSVAGEVIASTFDEPATRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE   DVVILLDSITRL RAYN ++P+SGK+LTGGVDANALQRPKRF
Sbjct: 241 QVAEMVIEKAKRLVEMKHDVVILLDSITRLARAYNTVIPASGKVLTGGVDANALQRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTIIGTAL++TGSRMD+VI+EEFKGTGN E+ LER++A+KR++P++++
Sbjct: 301 FGAARNIEEGGSLTIIGTALIETGSRMDDVIYEEFKGTGNMEVHLERRLAEKRVYPSINL 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            KSGTR+E++L++ + LQK+++LR+ +  M+  +A+EFL+DK++QTK+N +FF  M +
Sbjct: 361 NKSGTRREEMLIKPEILQKIWVLRKFIHDMDEVEAMEFLLDKIRQTKNNAEFFDLMRR 418


>gi|161524617|ref|YP_001579629.1| transcription termination factor Rho [Burkholderia multivorans ATCC
           17616]
 gi|189350627|ref|YP_001946255.1| transcription termination factor Rho [Burkholderia multivorans ATCC
           17616]
 gi|221198099|ref|ZP_03571145.1| transcription termination factor Rho [Burkholderia multivorans
           CGD2M]
 gi|221208410|ref|ZP_03581413.1| transcription termination factor Rho [Burkholderia multivorans
           CGD2]
 gi|221215162|ref|ZP_03588129.1| transcription termination factor Rho [Burkholderia multivorans
           CGD1]
 gi|254252240|ref|ZP_04945558.1| Transcription termination factor [Burkholderia dolosa AUO158]
 gi|330817184|ref|YP_004360889.1| transcription termination factor Rho [Burkholderia gladioli BSR3]
 gi|124894849|gb|EAY68729.1| Transcription termination factor [Burkholderia dolosa AUO158]
 gi|160342046|gb|ABX15132.1| transcription termination factor Rho [Burkholderia multivorans ATCC
           17616]
 gi|189334649|dbj|BAG43719.1| transcription termination factor [Burkholderia multivorans ATCC
           17616]
 gi|221165098|gb|EED97577.1| transcription termination factor Rho [Burkholderia multivorans
           CGD1]
 gi|221171823|gb|EEE04267.1| transcription termination factor Rho [Burkholderia multivorans
           CGD2]
 gi|221182031|gb|EEE14432.1| transcription termination factor Rho [Burkholderia multivorans
           CGD2M]
 gi|327369577|gb|AEA60933.1| transcription termination factor Rho [Burkholderia gladioli BSR3]
          Length = 420

 Score =  556 bits (1433), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 262/418 (62%), Positives = 344/418 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK+   ++L+  A  LEIENAN +RKQELMF+ILK  +     I G+G +EVL D
Sbjct: 1   MHLSELKSLHVSELIEMANGLEIENANRLRKQELMFAILKKRAKTGETIFGDGTLEVLPD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSP+ +YLA  DDIY+SPSQI+ F+L TGDT+EG +R P++GERYFAL+KV+ +N
Sbjct: 61  GFGFLRSPEMSYLASTDDIYISPSQIRRFNLHTGDTIEGEVRTPKDGERYFALVKVDKVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
              PE  ++KI F+NLTPL+P+K  ++E      ++++ R+ID+IAPIGKGQR L+VA P
Sbjct: 121 GQPPEASKHKIMFENLTPLHPNKPLSLEREMRGEENVTGRIIDMIAPIGKGQRGLLVASP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           ++GKT++LQ+IAH+IK+NHP+  L VLLIDERPEEVT+MQRSV GEVI+STFDE A RHV
Sbjct: 181 KSGKTVMLQHIAHAIKQNHPDVILFVLLIDERPEEVTEMQRSVAGEVIASTFDEPATRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE   DVVILLDSITRL RAYN ++P+SGK+LTGGVDANALQRPKRF
Sbjct: 241 QVAEMVIEKAKRLVEMKHDVVILLDSITRLARAYNTVIPASGKVLTGGVDANALQRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTIIGTAL++TGSRMD+VI+EEFKGTGN E+ LER++A+KR++P++++
Sbjct: 301 FGAARNIEEGGSLTIIGTALIETGSRMDDVIYEEFKGTGNMEVHLERRLAEKRVYPSINL 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            KSGTR+E++L++   LQK+++LR+ +  M+  +A+EFL+DK++QTK N +FF  M +
Sbjct: 361 NKSGTRREEMLIKPDILQKIWVLRKFIHDMDEVEAMEFLLDKIRQTKSNSEFFDLMRR 418


>gi|220904724|ref|YP_002480036.1| transcription termination factor Rho [Desulfovibrio desulfuricans
           subsp. desulfuricans str. ATCC 27774]
 gi|219869023|gb|ACL49358.1| transcription termination factor Rho [Desulfovibrio desulfuricans
           subsp. desulfuricans str. ATCC 27774]
          Length = 431

 Score =  556 bits (1432), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 273/421 (64%), Positives = 343/421 (81%), Gaps = 4/421 (0%)

Query: 2   SEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVL 61
           S + L +LK +S  +L+  AE  EIENA+ MRKQEL+F++L   + ++  I G+GV+E+L
Sbjct: 14  SALSLTDLKTRSMQELMDLAEQYEIENASSMRKQELIFALLSTCASQNGAIYGDGVLEIL 73

Query: 62  QDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNA 121
            DGFGFLRSP  +Y+ GPDDIYVSPSQI+ FSL+ GD V G IR P+EGERYFALLKV  
Sbjct: 74  PDGFGFLRSPLCSYMPGPDDIYVSPSQIRRFSLRKGDIVSGQIRPPKEGERYFALLKVTE 133

Query: 122 INFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVA 181
           I F+ PE  +N + FDNLTP+YPD +  ME  N E K++S+RVID++APIG+GQR LIVA
Sbjct: 134 IGFEPPEHAKNLVLFDNLTPIYPDHQLVME--NGE-KNLSNRVIDIMAPIGRGQRGLIVA 190

Query: 182 PPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQ-GEVISSTFDESAA 240
           PPRTGKTILLQ++A++I  N+PE YLIVLLIDERPEEVTDM+R+V+  EVISSTFDE   
Sbjct: 191 PPRTGKTILLQSLANAINANNPEVYLIVLLIDERPEEVTDMERTVKKAEVISSTFDEPPQ 250

Query: 241 RHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRP 300
           RHVQV EMV+ KAK LVE   DVVILLDSITRL RAYN + PSSG++L+GG+DANALQRP
Sbjct: 251 RHVQVCEMVLEKAKRLVERKRDVVILLDSITRLGRAYNAVTPSSGRVLSGGLDANALQRP 310

Query: 301 KRFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPA 360
           KRFFGAARNI+EGGSLTII TAL+DTGSRMDEVIFEEFKGTGN EI L+R +++KR+FPA
Sbjct: 311 KRFFGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNMEIYLDRHLSEKRVFPA 370

Query: 361 MDIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMN 420
           +DI ++GTRKEDLL+    L +V++LR+I++ M++ D++EFL+DK++ TK NKDF  +M 
Sbjct: 371 IDINRTGTRKEDLLLPEDVLNRVWILRKILAPMSAIDSMEFLLDKMRGTKSNKDFMNAMG 430

Query: 421 K 421
           K
Sbjct: 431 K 431


>gi|53723584|ref|YP_103024.1| transcription termination factor Rho [Burkholderia mallei ATCC
           23344]
 gi|67639668|ref|ZP_00438508.1| transcription termination factor Rho [Burkholderia mallei GB8 horse
           4]
 gi|121599564|ref|YP_993174.1| transcription termination factor Rho [Burkholderia mallei SAVP1]
 gi|124385334|ref|YP_001026051.1| transcription termination factor Rho [Burkholderia mallei NCTC
           10229]
 gi|126448751|ref|YP_001080680.1| transcription termination factor Rho [Burkholderia mallei NCTC
           10247]
 gi|167003447|ref|ZP_02269233.1| transcription termination factor Rho [Burkholderia mallei PRL-20]
 gi|254177513|ref|ZP_04884168.1| transcription termination factor Rho [Burkholderia mallei ATCC
           10399]
 gi|254199970|ref|ZP_04906336.1| transcription termination factor Rho [Burkholderia mallei FMH]
 gi|254206303|ref|ZP_04912655.1| transcription termination factor Rho [Burkholderia mallei JHU]
 gi|254358284|ref|ZP_04974557.1| transcription termination factor Rho [Burkholderia mallei
           2002721280]
 gi|52427007|gb|AAU47600.1| transcription termination factor Rho [Burkholderia mallei ATCC
           23344]
 gi|121228374|gb|ABM50892.1| transcription termination factor Rho [Burkholderia mallei SAVP1]
 gi|124293354|gb|ABN02623.1| transcription termination factor Rho [Burkholderia mallei NCTC
           10229]
 gi|126241621|gb|ABO04714.1| transcription termination factor Rho [Burkholderia mallei NCTC
           10247]
 gi|147749566|gb|EDK56640.1| transcription termination factor Rho [Burkholderia mallei FMH]
 gi|147753746|gb|EDK60811.1| transcription termination factor Rho [Burkholderia mallei JHU]
 gi|148027411|gb|EDK85432.1| transcription termination factor Rho [Burkholderia mallei
           2002721280]
 gi|160698552|gb|EDP88522.1| transcription termination factor Rho [Burkholderia mallei ATCC
           10399]
 gi|238520256|gb|EEP83718.1| transcription termination factor Rho [Burkholderia mallei GB8 horse
           4]
 gi|243061010|gb|EES43196.1| transcription termination factor Rho [Burkholderia mallei PRL-20]
          Length = 420

 Score =  556 bits (1432), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 261/418 (62%), Positives = 346/418 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L ELK+   ++L+  A  LEIENAN +RKQELMF+ILK  +     I G+G +EVL D
Sbjct: 1   MHLSELKSLHVSELIEMANGLEIENANRLRKQELMFAILKKRAKTGETIFGDGTLEVLPD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSP+ +YLA  DDIY+SPSQI+ F+L TGDT+EG +R P++GERYFAL+KV+ +N
Sbjct: 61  GFGFLRSPEMSYLASTDDIYISPSQIRRFNLHTGDTIEGEVRTPKDGERYFALVKVDKVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
              P+  ++KI F+NLTPL+P+K  ++E      ++++ R+ID+IAPIGKGQR L+VA P
Sbjct: 121 GQPPKASKHKIMFENLTPLHPNKPLSLEREMRGEENVTGRIIDMIAPIGKGQRGLLVASP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           ++GKT++LQ+IAH+IK+NHP+  L VLLIDERPEEVT+MQRSV GEVI+STFDE A RHV
Sbjct: 181 KSGKTVMLQHIAHAIKQNHPDVILFVLLIDERPEEVTEMQRSVAGEVIASTFDEPATRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE   DVVILLDSITRL RAYN ++P+SGK+LTGGVDANALQRPKRF
Sbjct: 241 QVAEMVIEKAKRLVEMKHDVVILLDSITRLARAYNTVIPASGKVLTGGVDANALQRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSLTIIGTAL++TGSRMD+VI+EEFKGTGN E+ LER++A+KR++P++++
Sbjct: 301 FGAARNIEEGGSLTIIGTALIETGSRMDDVIYEEFKGTGNMEVHLERRLAEKRVYPSINL 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            KSGTR+E++L++ + LQK+++LR+ +  M+  +A+EFL+DK++QTK+N +FF  M +
Sbjct: 361 NKSGTRREEMLIKPEILQKIWVLRKFIHDMDEVEAMEFLLDKIRQTKNNAEFFDLMRR 418


>gi|283853059|ref|ZP_06370315.1| transcription termination factor Rho [Desulfovibrio sp. FW1012B]
 gi|283571526|gb|EFC19530.1| transcription termination factor Rho [Desulfovibrio sp. FW1012B]
          Length = 435

 Score =  556 bits (1432), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 274/420 (65%), Positives = 337/420 (80%), Gaps = 3/420 (0%)

Query: 2   SEMKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVL 61
           + M L ELK KS  +L+  A    +EN N MRKQEL+F++L+  + ++  I GEGV+E+L
Sbjct: 19  TSMNLSELKLKSMPELMDLAVQYNVENPNGMRKQELIFALLQSCASQNGAIFGEGVLEIL 78

Query: 62  QDGFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNA 121
            DGFGFLRSP  +Y+ GPDDIYVSPSQI+ F L+ GD V G IR P+EGERYFALL+V  
Sbjct: 79  PDGFGFLRSPMYSYMPGPDDIYVSPSQIRRFGLRKGDVVSGQIRPPKEGERYFALLRVGE 138

Query: 122 INFDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVA 181
           I F  PE  RN + FDNLTPLYPDKRF +E N  EN   SSRVIDL+APIG GQR +IVA
Sbjct: 139 IGFAPPEASRNLVLFDNLTPLYPDKRFVVE-NGAEN--FSSRVIDLLAPIGHGQRGIIVA 195

Query: 182 PPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAAR 241
           PPRTGKT+LLQ IA+SI  N P+ +LIVLLIDERPEEVTDM+R+V+ EV+SSTFDE   R
Sbjct: 196 PPRTGKTMLLQTIANSINANRPDVFLIVLLIDERPEEVTDMERTVKAEVVSSTFDEPPQR 255

Query: 242 HVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPK 301
           HVQVAEMVI KAK LVE  +DVVILLDSITRL RAYN + PSSG++L+GG+DANALQRPK
Sbjct: 256 HVQVAEMVIEKAKRLVERKIDVVILLDSITRLGRAYNAVTPSSGRVLSGGLDANALQRPK 315

Query: 302 RFFGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAM 361
           RFFGAARNI+ GGSLTII TAL+DTGSRMDEVIFEEFKGTGN EI L+R +A+KR+FPA+
Sbjct: 316 RFFGAARNIEGGGSLTIIATALIDTGSRMDEVIFEEFKGTGNMEIYLDRHLAEKRVFPAI 375

Query: 362 DIIKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
           DI +SGTRKE+LL++   L +V++LR++++ MN  D++EFL+DK++ TK N++F   MN+
Sbjct: 376 DINRSGTRKEELLLDTDVLNRVWILRKLLAPMNPIDSMEFLLDKMRHTKSNREFLDLMNR 435


>gi|254784463|ref|YP_003071891.1| transcription termination factor Rho [Teredinibacter turnerae
           T7901]
 gi|237685295|gb|ACR12559.1| transcription termination factor Rho [Teredinibacter turnerae
           T7901]
          Length = 419

 Score =  556 bits (1432), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 263/419 (62%), Positives = 344/419 (82%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L +LK K   +L+  A+ + +E+    RKQ+++F+ILK  +    +I G+GV+E+LQD
Sbjct: 1   MNLTDLKTKPIEELIDIAKEMGMESLARSRKQDVIFNILKRHARSGEDIYGDGVLEILQD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRS  ++YLAGPDDIYVSPSQI+ F+L+TGD++ G IR P+EGERYFALLKVN IN
Sbjct: 61  GFGFLRSSGSSYLAGPDDIYVSPSQIRRFNLRTGDSIAGKIRPPKEGERYFALLKVNEIN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
           FD PE  RNKI F+NLTPL+P  R  +E  N  ++D++ R+IDLI+PIGKGQR LIVAPP
Sbjct: 121 FDKPENSRNKILFENLTPLFPTSRLVLETGNGSSEDLTGRIIDLISPIGKGQRGLIVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           + GKTI++QN+A +I +N+PEC+LIVLLIDERPEEVT+MQRSV+GEV++STFDE  +RHV
Sbjct: 181 KAGKTIMMQNVAQAITRNNPECHLIVLLIDERPEEVTEMQRSVRGEVVASTFDEPPSRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI +AK LVE+  DVVILLDSITRL RAYN ++PSSGK+LTGGVDA+AL+RPKRF
Sbjct: 241 QVAEMVIERAKRLVEHKKDVVILLDSITRLARAYNTVIPSSGKVLTGGVDAHALERPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARNI+EGGSL+I+ TAL+DTGS+MDEVI+EEFKGTGN E+ L+RK+A+KR++PA++I
Sbjct: 301 FGAARNIEEGGSLSIVATALIDTGSKMDEVIYEEFKGTGNLELHLDRKVAEKRVYPAINI 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNKQ 422
            +SGTR+EDLL+   +L +V++LR+++  M    A EFL+D+LK  K N +FF SM  +
Sbjct: 361 RRSGTRREDLLMREDELSRVWILRKLLHDMEDIAATEFLVDRLKGFKTNDEFFLSMKSK 419


>gi|224825639|ref|ZP_03698743.1| transcription termination factor Rho [Lutiella nitroferrum 2002]
 gi|224601863|gb|EEG08042.1| transcription termination factor Rho [Lutiella nitroferrum 2002]
          Length = 418

 Score =  556 bits (1432), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 266/418 (63%), Positives = 348/418 (83%)

Query: 4   MKLQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQD 63
           M L +LK+   T+L+  A + EI+ AN +RKQ+L+F++LK  + +   I G+G +EVL D
Sbjct: 1   MHLSDLKHLPVTELVEKAIANEIDGANRLRKQDLIFALLKNQAKKGESIFGDGTLEVLPD 60

Query: 64  GFGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAIN 123
           GFGFLRSPD++YLAGPDDIYVSPSQI+ F+L TGD++EG IR P++GERYFAL+KV+ +N
Sbjct: 61  GFGFLRSPDSSYLAGPDDIYVSPSQIRRFNLHTGDSIEGEIRTPKDGERYFALVKVDKVN 120

Query: 124 FDVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPP 183
              PE  ++KI F+NLTPL+P +R  +E +    ++I+SRVIDLIAPIGKGQR L+VAPP
Sbjct: 121 GGPPENAKHKILFENLTPLFPTERLVLERDIRAEENITSRVIDLIAPIGKGQRGLLVAPP 180

Query: 184 RTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHV 243
           ++GKT++LQN+AH+I  NHPE  LIVLLIDERPEEVT+M RSV+GEV+SSTFDE A RHV
Sbjct: 181 KSGKTVMLQNLAHAITANHPEVELIVLLIDERPEEVTEMTRSVRGEVVSSTFDEPATRHV 240

Query: 244 QVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRF 303
           QVAEMVI KAK LVE+  DVVILLDSITRL RAYN ++P+SGK+LTGGVD+NALQRPKRF
Sbjct: 241 QVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVIPASGKVLTGGVDSNALQRPKRF 300

Query: 304 FGAARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDI 363
           FGAARN++EGGSLTII TAL+DTGSRMD+VI+EEFKGTGN EI L+R++A+KRIFPA++I
Sbjct: 301 FGAARNVEEGGSLTIIATALIDTGSRMDDVIYEEFKGTGNMEIHLDRRMAEKRIFPAINI 360

Query: 364 IKSGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFFYSMNK 421
            +SGTR+E+LL+ +  LQ++++LR+++  M+  +A+EFL DK++ TK+N  FF SM +
Sbjct: 361 NRSGTRREELLIPQDQLQRIWVLRKLLYPMDDLEAMEFLQDKMRATKNNLAFFDSMRR 418


>gi|266618658|pdb|3ICE|A Chain A, Rho Transcription Termination Factor Bound To Rna And Adp-
           Bef3
 gi|266618659|pdb|3ICE|B Chain B, Rho Transcription Termination Factor Bound To Rna And Adp-
           Bef3
 gi|266618660|pdb|3ICE|C Chain C, Rho Transcription Termination Factor Bound To Rna And Adp-
           Bef3
 gi|266618661|pdb|3ICE|D Chain D, Rho Transcription Termination Factor Bound To Rna And Adp-
           Bef3
 gi|266618662|pdb|3ICE|E Chain E, Rho Transcription Termination Factor Bound To Rna And Adp-
           Bef3
 gi|266618663|pdb|3ICE|F Chain F, Rho Transcription Termination Factor Bound To Rna And Adp-
           Bef3
          Length = 422

 Score =  556 bits (1432), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 266/411 (64%), Positives = 330/411 (80%)

Query: 6   LQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQDGF 65
           L ELKN   ++L+   E+  +EN    RKQ+++F+ILK  +    +I G+GV+E+LQDGF
Sbjct: 6   LTELKNTPVSELITLGENXGLENLARXRKQDIIFAILKQHAKSGEDIFGDGVLEILQDGF 65

Query: 66  GFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAINFD 125
           GFLRS D++YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P+EGERYFALLKVN +NFD
Sbjct: 66  GFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNEVNFD 125

Query: 126 VPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPPRT 185
            PE  RNKI F+NLTPL+ + R   E  N   +D+++RV+DL +PIG+GQR LIVAPP+ 
Sbjct: 126 KPENARNKILFENLTPLHANSRLRXERGNGSTEDLTARVLDLASPIGRGQRGLIVAPPKA 185

Query: 186 GKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHVQV 245
           GKT LLQNIA SI  NHP+C L VLLIDERPEEVT+ QR V+GEV++STFDE A+RHVQV
Sbjct: 186 GKTXLLQNIAQSIAYNHPDCVLXVLLIDERPEEVTEXQRLVKGEVVASTFDEPASRHVQV 245

Query: 246 AEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRFFG 305
           AE VI KAK LVE+  DV+ILLDSITRL RAYN ++P+SGK+LTGGVDANAL RPKRFFG
Sbjct: 246 AEXVIEKAKRLVEHKKDVIILLDSITRLARAYNTVVPASGKVLTGGVDANALHRPKRFFG 305

Query: 306 AARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDIIK 365
           AARN++EGGSLTII TAL+DTGS+ DEVI+EEFKGTGN E+ L RKIA+KR+FPA+D  +
Sbjct: 306 AARNVEEGGSLTIIATALIDTGSKXDEVIYEEFKGTGNXELHLSRKIAEKRVFPAIDYNR 365

Query: 366 SGTRKEDLLVERQDLQKVFMLRRIVSSMNSSDAIEFLIDKLKQTKDNKDFF 416
           SGTRKE+LL  +++LQK ++LR+I+      DA EFLI+KL  TK N DFF
Sbjct: 366 SGTRKEELLTTQEELQKXWILRKIIHPXGEIDAXEFLINKLAXTKTNDDFF 416


>gi|34811277|pdb|1PV4|A Chain A, X-Ray Crystal Structure Of The Rho Transcription
           Termination Factor In Complex With Single Stranded Dna
 gi|34811278|pdb|1PV4|B Chain B, X-Ray Crystal Structure Of The Rho Transcription
           Termination Factor In Complex With Single Stranded Dna
 gi|34811279|pdb|1PV4|C Chain C, X-Ray Crystal Structure Of The Rho Transcription
           Termination Factor In Complex With Single Stranded Dna
 gi|34811280|pdb|1PV4|D Chain D, X-Ray Crystal Structure Of The Rho Transcription
           Termination Factor In Complex With Single Stranded Dna
 gi|34811281|pdb|1PV4|E Chain E, X-Ray Crystal Structure Of The Rho Transcription
           Termination Factor In Complex With Single Stranded Dna
 gi|34811282|pdb|1PV4|F Chain F, X-Ray Crystal Structure Of The Rho Transcription
           Termination Factor In Complex With Single Stranded Dna
          Length = 419

 Score =  556 bits (1432), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 266/411 (64%), Positives = 330/411 (80%)

Query: 6   LQELKNKSPTKLLAFAESLEIENANVMRKQELMFSILKVLSGRDVEIIGEGVIEVLQDGF 65
           L ELKN   ++L+   E+  +EN    RKQ+++F+ILK  +    +I G+GV+E+LQDGF
Sbjct: 3   LTELKNTPVSELITLGENXGLENLARXRKQDIIFAILKQHAKSGEDIFGDGVLEILQDGF 62

Query: 66  GFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDTVEGSIRAPREGERYFALLKVNAINFD 125
           GFLRS D++YLAGPDDIYVSPSQI+ F+L+TGDT+ G IR P+EGERYFALLKVN +NFD
Sbjct: 63  GFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNEVNFD 122

Query: 126 VPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPPRT 185
            PE  RNKI F+NLTPL+ + R   E  N   +D+++RV+DL +PIG+GQR LIVAPP+ 
Sbjct: 123 KPENARNKILFENLTPLHANSRLRXERGNGSTEDLTARVLDLASPIGRGQRGLIVAPPKA 182

Query: 186 GKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHVQV 245
           GKT LLQNIA SI  NHP+C L VLLIDERPEEVT+ QR V+GEV++STFDE A+RHVQV
Sbjct: 183 GKTXLLQNIAQSIAYNHPDCVLXVLLIDERPEEVTEXQRLVKGEVVASTFDEPASRHVQV 242

Query: 246 AEMVIAKAKCLVEYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVDANALQRPKRFFG 305
           AE VI KAK LVE+  DV+ILLDSITRL RAYN ++P+SGK+LTGGVDANAL RPKRFFG
Sbjct: 243 AEXVIEKAKRLVEHKKDVIILLDSITRLARAYNTVVPASGKVLTGGVDANALHRPKRFFG 302

Query: 306 AARNIKEGGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDIIK 365