RPSBLAST alignment for GI: 254780810 and conserved domain: TIGR01039

>gnl|CDD|130111 TIGR01039, atpD, ATP synthase, F1 beta subunit. The sequences of ATP synthase F1 alpha and beta subunits are related and both contain a nucleotide-binding site for ATP and ADP. They have a common amino terminal domain but vary at the C-terminus. The beta chain has catalytic activity, while the alpha chain is a regulatory subunit. Proton translocating ATP synthase, F1 beta subunit is homologous to proton translocating ATP synthase archaeal/vacuolar(V1), A subunit. Length = 461
 Score = 53.6 bits (129), Expect = 9e-08
 Identities = 71/270 (26%), Positives = 113/270 (41%), Gaps = 47/270 (17%)

Query: 137 DNLTPLYPDKRFNMELNNPENKDISSR---------VIDLIAPIGKGQRSLIVAPPRTGK 187
           D   P+   +R+ +    P  ++ S++         VIDL+AP  KG +  +      GK
Sbjct: 97  DEKGPIPAKERWPIHRKAPSFEEQSTKVEILETGIKVIDLLAPYAKGGKIGLFGGAGVGK 156

Query: 188 TILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSV-QGEVISST------FDESAA 240
           T+L+Q + ++I K H   Y +   + ER  E  D+   + +  VI  T       +E   
Sbjct: 157 TVLIQELINNIAKEH-GGYSVFAGVGERTREGNDLYHEMKESGVIDKTALVYGQMNEPPG 215

Query: 241 RHVQVAEMVIAKAKCLVEY-----GLDVVILLDSITRLCRAYNVL------MPSS-GKIL 288
             ++VA   +  A    EY     G DV++ +D+I R  +A + +      MPS+ G   
Sbjct: 216 ARMRVALTGLTMA----EYFRDEQGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQP 271

Query: 289 TGGVDANALQRPKRFFGAARNIKEGGSLTIIGTALVDTGSRMD---EVIFEEFKGTGNSE 345
           T   +   LQ  +R           GS+T +    V      D      F     T    
Sbjct: 272 TLATEMGELQ--ERITSTK-----TGSITSVQAVYVPADDLTDPAPATTFAHLDAT---- 320

Query: 346 IVLERKIADKRIFPAMDIIKSGTRKEDLLV 375
            VL RKIA+  I+PA+D + S +R  D  V
Sbjct: 321 TVLSRKIAELGIYPAVDPLDSTSRLLDPSV 350