RPSBLAST alignment for GI: 254780810 and conserved domain: PRK07960

>gnl|CDD|181182 PRK07960, fliI, flagellum-specific ATP synthase; Validated. Length = 455
 Score = 60.6 bits (147), Expect = 9e-10
 Identities = 66/243 (27%), Positives = 114/243 (46%), Gaps = 14/243 (5%)

Query: 159 DISSRVIDLIAPIGKGQRSLIVAPPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEE 218
           D   R I+ +  +G+GQR  + A    GK++LL  +A   + +     ++V LI ER  E
Sbjct: 160 DTGVRAINALLTVGRGQRMGLFAGSGVGKSVLLGMMARYTQAD----VIVVGLIGERGRE 215

Query: 219 VTDMQRSVQGE-------VISSTFDESAARHVQVAEMVIAKAKCLVEYGLDVVILLDSIT 271
           V D   ++ G        VI++  D S    +Q A      A+   + G  V++++DS+T
Sbjct: 216 VKDFIENILGAEGRARSVVIAAPADVSPLLRMQGAAYATRIAEDFRDRGQHVLLIMDSLT 275

Query: 272 RLCRAYNVLMPSSGKI-LTGGVDANALQR-PKRFFGAARNIKEGGSLTIIGTALVDTGSR 329
           R   A   +  + G+   T G   +   + P     A   I  GGS+T   T L +   +
Sbjct: 276 RYAMAQREIALAIGEPPATKGYPPSVFAKLPALVERAGNGISGGGSITAFYTVLTEGDDQ 335

Query: 330 MDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDIIKSGTRKEDLLVERQDLQKVFMLRRI 389
            D  I +  +   +  IVL R++A+   +PA+DI  S +R    L++ Q   +V   +++
Sbjct: 336 QDP-IADSARAILDGHIVLSRRLAEAGHYPAIDIEASISRAMTALIDEQHYARVRQFKQL 394

Query: 390 VSS 392
           +SS
Sbjct: 395 LSS 397