RPSBLAST alignment for GI: 254780810 and conserved domain: cd01134

>gnl|CDD|30000 cd01134, V_A-ATPase_A, V/A-type ATP synthase catalytic subunit A. These ATPases couple ATP hydrolysis to the build up of a H+ gradient, but V-type ATPases do not catalyze the reverse reaction. The Vacuolar (V-type) ATPase is found in the membranes of vacuoles, the golgi apparatus and in other coated vesicles in eukaryotes. Archaea have a protein which is similar in sequence to V-ATPases, but functions like an F-ATPase (called A-ATPase). A similar protein is also found in a few bacteria.. Length = 369
 Score = 39.4 bits (92), Expect = 0.002
 Identities = 62/242 (25%), Positives = 100/242 (41%), Gaps = 60/242 (24%)

Query: 163 RVIDLIAPIGKGQRSLIVAPPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTD- 221
           RV+D + P+ KG  + I  P   GKT++      S+ K      +I +   ER  E+T+ 
Sbjct: 146 RVLDTLFPVVKGGTAAIPGPFGCGKTVI----QQSLSKYSNSDIVIYVGCGERGNEMTEV 201

Query: 222 ----------------MQRSVQGEVISSTFD-ESAARHVQVAEMVIAKAKCLVEY----G 260
                           M+R+V   +I++T +   AAR     E  I     + EY    G
Sbjct: 202 LEEFPELTDPVTGEPLMKRTV---LIANTSNMPVAAR-----EASIYTGITIAEYFRDMG 253

Query: 261 LDVVILLDSITRLCRAYNVLMPSSGKI----LTGGVDANALQRPKRFFGAARNIK----- 311
            +V ++ DS +R   A   L   SG++       G  A    R   F+  A  +K     
Sbjct: 254 YNVALMADSTSRWAEA---LREISGRLEEMPGEEGYPAYLGARLASFYERAGRVKCLGSP 310

Query: 312 -EGGSLTIIGTALVDTGSRMDEV------IFEEFKGTGNSEIVLERKIADKRIFPAMDII 364
              GS+TI+G      G   + V      I + F G       L++K+A +R FP+++ +
Sbjct: 311 GREGSVTIVGAVSPPGGDFSEPVTQATLRIVQVFWG-------LDKKLAQRRHFPSINWL 363

Query: 365 KS 366
            S
Sbjct: 364 IS 365