RPSBLAST alignment for GI: 254780810 and conserved domain: COG0056

>gnl|CDD|30405 COG0056, AtpA, F0F1-type ATP synthase, alpha subunit [Energy production and conversion]. Length = 504
 Score = 42.9 bits (101), Expect = 2e-04
 Identities = 32/122 (26%), Positives = 58/122 (47%), Gaps = 11/122 (9%)

Query: 164 VIDLIAPIGKGQRSLIVAPPRTGKT-ILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDM 222
            ID + PIG+GQR LI+   +TGKT I +  I +           I + I ++   V ++
Sbjct: 152 AIDALIPIGRGQRELIIGDRQTGKTAIAIDTIINQKGSG---VKCIYVAIGQKRSTVANV 208

Query: 223 QRSVQGE-------VISSTFDESAARHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCR 275
            R+++         V++++  +SA           A A+   + G DV+I+ D +++   
Sbjct: 209 VRTLEEHGAMDYTIVVAASASDSAPLQYLAPYAGCAMAEYFRDNGKDVLIVYDDLSKHAV 268

Query: 276 AY 277
           AY
Sbjct: 269 AY 270