RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780811|ref|YP_003065224.1| hypothetical protein CLIBASIA_03510 [Candidatus Liberibacter asiaticus str. psy62] (178 letters) >gnl|CDD|146343 pfam03653, UPF0093, Uncharacterized protein family (UPF0093). Length = 147 Score = 154 bits (391), Expect = 2e-38 Identities = 65/140 (46%), Positives = 94/140 (67%), Gaps = 4/140 (2%) Query: 43 IKSIHILSVISWMAGLLYMPRIFVYHSLSAP-DTDQYKTFEIMEERLFKVIMNPAMILSW 101 IK++HI+ VISWMAGL Y+PR+FVYH+ +AP + + F+IME RL + IMNPAMIL+W Sbjct: 8 IKALHIIFVISWMAGLFYLPRLFVYHAEAAPGSDESDEIFKIMERRLLRYIMNPAMILTW 67 Query: 102 VCG---LYLAWKTFYIHIGWLRLKMISVLFLSFYHVYLSFVMRKFRDKKLFHSPKYFKII 158 V G L + GWL +K+ VL L+ YH +L + F + S ++++I+ Sbjct: 68 VFGLLLLVITPGLLDWSSGWLHVKLALVLLLTGYHGWLGKYRKDFAAGENTRSGRFYRIL 127 Query: 159 NEIPTLIMIIIVFLSVIKPF 178 NE+PTL++I+IV L V+KPF Sbjct: 128 NEVPTLLLIVIVILVVVKPF 147 >gnl|CDD|32164 COG1981, COG1981, Predicted membrane protein [Function unknown]. Length = 149 Score = 129 bits (326), Expect = 4e-31 Identities = 59/139 (42%), Positives = 92/139 (66%), Gaps = 3/139 (2%) Query: 43 IKSIHILSVISWMAGLLYMPRIFVYHSLSAPDTDQYKTFEIMEERLFKVIMNPAMILSWV 102 +K+ H+++VISWMAGL Y+PR+FVYH+ + ++ +T ++ME RL++ IMNPAM+++ + Sbjct: 11 VKAFHLIAVISWMAGLFYLPRLFVYHAEADGGSELVETLKVMERRLYRFIMNPAMLVTLI 70 Query: 103 CGLYL---AWKTFYIHIGWLRLKMISVLFLSFYHVYLSFVMRKFRDKKLFHSPKYFKIIN 159 GL L + GWL K+ VL L YH Y +++KF + S +++++ N Sbjct: 71 FGLLLLLAEPFIYGFGSGWLHAKLTLVLLLLGYHGYCGRLLKKFARGENVRSARFYRVFN 130 Query: 160 EIPTLIMIIIVFLSVIKPF 178 EIPTL+MI IV L V+KPF Sbjct: 131 EIPTLLMIAIVILVVVKPF 149 >gnl|CDD|30690 COG0342, SecD, Preprotein translocase subunit SecD [Intracellular trafficking and secretion]. Length = 506 Score = 26.9 bits (59), Expect = 2.8 Identities = 14/55 (25%), Positives = 24/55 (43%), Gaps = 1/55 (1%) Query: 10 GKKAQAIAFIALFVFLFLSLLCFFFLTSQFNLCIKSIHILSVISWMAGLLYMPRI 64 G A I + VF+ L + + L + + IL+V+S + L +P I Sbjct: 345 GLIAGLIGLALVAVFMLLYYRLAGVIAAIA-LGLNGVLILAVLSLLGATLTLPGI 398 >gnl|CDD|100003 cd05844, GT1_like_7, Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.. Length = 367 Score = 26.8 bits (60), Expect = 3.6 Identities = 9/27 (33%), Positives = 12/27 (44%), Gaps = 4/27 (14%) Query: 51 VISWMAGLLYMPRIFVYHSLSAPDTDQ 77 V M RIF+ S++AP D Sbjct: 258 VRELMRR----ARIFLQPSVTAPSGDA 280 >gnl|CDD|38741 KOG3533, KOG3533, KOG3533, Inositol 1,4,5-trisphosphate receptor [Signal transduction mechanisms]. Length = 2706 Score = 26.5 bits (58), Expect = 4.3 Identities = 8/53 (15%), Positives = 21/53 (39%), Gaps = 1/53 (1%) Query: 1 MKFFLSDSIGKKAQAIAFIALFVFLFLSLLCFFFLTSQFNLCIKSIHILSVIS 53 + +L G + + I + + + ++ NL K +H++S + Sbjct: 2304 IAHYLRKIYGIRTILASLILRLISS-IGVTPTLYILGALNLVNKIVHVVSFVG 2355 >gnl|CDD|36049 KOG0831, KOG0831, KOG0831, Acyl-CoA:diacylglycerol acyltransferase (DGAT) [Lipid transport and metabolism]. Length = 334 Score = 25.2 bits (55), Expect = 9.5 Identities = 15/83 (18%), Positives = 31/83 (37%), Gaps = 11/83 (13%) Query: 8 SIGKKAQAIAFIALFVFLFLSLLCFFFLTSQFNLCIKSIHILSVISWMAGLLYMPRIFVY 67 ++ Q +A +A F+F+ L L F +L W +LY +++Y Sbjct: 10 PWERRLQTLAVLA-FIFMTLILPLISFNVP--------FALLFTRFWPLAILYA--VWLY 58 Query: 68 HSLSAPDTDQYKTFEIMEERLFK 90 + P ++ ++K Sbjct: 59 YDRDTPKKGGRRSNWFRNWPIWK 81 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.338 0.148 0.471 Gapped Lambda K H 0.267 0.0705 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 2,369,394 Number of extensions: 132856 Number of successful extensions: 1121 Number of sequences better than 10.0: 1 Number of HSP's gapped: 1084 Number of HSP's successfully gapped: 145 Length of query: 178 Length of database: 6,263,737 Length adjustment: 88 Effective length of query: 90 Effective length of database: 4,362,145 Effective search space: 392593050 Effective search space used: 392593050 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.8 bits) S2: 54 (24.6 bits)