RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254780811|ref|YP_003065224.1| hypothetical protein CLIBASIA_03510 [Candidatus Liberibacter asiaticus str. psy62] (178 letters) >2a1k_A GP32 single stranded DNA binding protein; Zn2+ binding subdomain, 5-stranded beta-sheet, OB fold; 2.00A {Enterobacteria phage RB69} (A:) Length = 233 Score = 27.1 bits (60), Expect = 1.3 Identities = 8/31 (25%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Query: 68 HSLSA-PDTDQYKTFEIMEERLFKVIMNPAM 97 LS D++K+FE + + +V+ A+ Sbjct: 194 VDLSEMTSKDKFKSFEELNTKFNQVLGTAAL 224 >2zhj_A Annexin A4; zynogen granule, membrane binding protein, metal binding protein, calcium, calcium/phospholipid-binding; 1.35A {Rattus norvegicus} PDB: 2zhi_A 2zoc_A 1ann_A 1i4a_A 1aow_A (A:89-247) Length = 159 Score = 24.8 bits (53), Expect = 7.1 Identities = 11/104 (10%), Positives = 28/104 (26%) Query: 66 VYHSLSAPDTDQYKTFEIMEERLFKVIMNPAMILSWVCGLYLAWKTFYIHIGWLRLKMIS 125 + ++ TD+ EI+ R + I G L + ++S Sbjct: 10 LRRAMKGAGTDEGCLIEILASRNPEEIRRINQTYQQQYGRSLEEDICSDTSFMFQRVLVS 69 Query: 126 VLFLSFYHVYLSFVMRKFRDKKLFHSPKYFKIINEIPTLIMIII 169 + +D + + + + + I+ Sbjct: 70 LTAGGRDEGNYLDDALVKQDAQDLYEAGEKRWGTDEVKFLSILC 113 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.338 0.148 0.471 Gapped Lambda K H 0.267 0.0580 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 1,363,849 Number of extensions: 57555 Number of successful extensions: 219 Number of sequences better than 10.0: 1 Number of HSP's gapped: 216 Number of HSP's successfully gapped: 30 Length of query: 178 Length of database: 4,956,049 Length adjustment: 83 Effective length of query: 95 Effective length of database: 2,150,234 Effective search space: 204272230 Effective search space used: 204272230 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.8 bits) S2: 52 (24.1 bits)