BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780811|ref|YP_003065224.1| hypothetical protein CLIBASIA_03510 [Candidatus Liberibacter asiaticus str. psy62] (178 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780811|ref|YP_003065224.1| hypothetical protein CLIBASIA_03510 [Candidatus Liberibacter asiaticus str. psy62] Length = 178 Score = 355 bits (910), Expect = e-100, Method: Compositional matrix adjust. Identities = 178/178 (100%), Positives = 178/178 (100%) Query: 1 MKFFLSDSIGKKAQAIAFIALFVFLFLSLLCFFFLTSQFNLCIKSIHILSVISWMAGLLY 60 MKFFLSDSIGKKAQAIAFIALFVFLFLSLLCFFFLTSQFNLCIKSIHILSVISWMAGLLY Sbjct: 1 MKFFLSDSIGKKAQAIAFIALFVFLFLSLLCFFFLTSQFNLCIKSIHILSVISWMAGLLY 60 Query: 61 MPRIFVYHSLSAPDTDQYKTFEIMEERLFKVIMNPAMILSWVCGLYLAWKTFYIHIGWLR 120 MPRIFVYHSLSAPDTDQYKTFEIMEERLFKVIMNPAMILSWVCGLYLAWKTFYIHIGWLR Sbjct: 61 MPRIFVYHSLSAPDTDQYKTFEIMEERLFKVIMNPAMILSWVCGLYLAWKTFYIHIGWLR 120 Query: 121 LKMISVLFLSFYHVYLSFVMRKFRDKKLFHSPKYFKIINEIPTLIMIIIVFLSVIKPF 178 LKMISVLFLSFYHVYLSFVMRKFRDKKLFHSPKYFKIINEIPTLIMIIIVFLSVIKPF Sbjct: 121 LKMISVLFLSFYHVYLSFVMRKFRDKKLFHSPKYFKIINEIPTLIMIIIVFLSVIKPF 178 >gi|254780142|ref|YP_003064555.1| DNA-directed RNA polymerase subunit beta' [Candidatus Liberibacter asiaticus str. psy62] Length = 1398 Score = 24.6 bits (52), Expect = 0.96, Method: Composition-based stats. Identities = 13/41 (31%), Positives = 19/41 (46%), Gaps = 1/41 (2%) Query: 67 YHSLSAPDTDQYKTFEIMEERLF-KVIMNPAMILSWVCGLY 106 Y + P+T Y+TF+ + LF I P +CG Y Sbjct: 36 YGEIKKPETINYRTFKPERDGLFCARIFGPIKDYECICGKY 76 >gi|254780226|ref|YP_003064639.1| translation-associated GTPase [Candidatus Liberibacter asiaticus str. psy62] Length = 367 Score = 22.7 bits (47), Expect = 4.1, Method: Compositional matrix adjust. Identities = 9/26 (34%), Positives = 15/26 (57%) Query: 139 VMRKFRDKKLFHSPKYFKIINEIPTL 164 V+R F+D+ + H IN+I T+ Sbjct: 104 VLRCFKDENIIHVEGRIDPINDIETI 129 >gi|254780793|ref|YP_003065206.1| integral membrane protein MviN [Candidatus Liberibacter asiaticus str. psy62] Length = 518 Score = 21.9 bits (45), Expect = 6.6, Method: Compositional matrix adjust. Identities = 9/30 (30%), Positives = 19/30 (63%), Gaps = 3/30 (10%) Query: 122 KMISVLFLSFYHVYLSFVMRKFRDKKLFHS 151 K+ V +++FY L+F+ R+ + +FH+ Sbjct: 36 KVTDVFYVAFY---LTFIFRRLAAEGIFHN 62 >gi|254780140|ref|YP_003064553.1| putative ABC transporter, substrate-binding protein [Candidatus Liberibacter asiaticus str. psy62] Length = 452 Score = 21.9 bits (45), Expect = 6.7, Method: Compositional matrix adjust. Identities = 9/29 (31%), Positives = 17/29 (58%), Gaps = 3/29 (10%) Query: 107 LAWKTFYIHIGWLRLKMISVLFLSFYHVY 135 + K +Y +G ++S+LF SF+ +Y Sbjct: 1 MESKNYYTSVGLF---VVSILFFSFFSIY 26 >gi|254780482|ref|YP_003064895.1| ribonuclease P [Candidatus Liberibacter asiaticus str. psy62] Length = 123 Score = 21.6 bits (44), Expect = 9.8, Method: Compositional matrix adjust. Identities = 11/31 (35%), Positives = 17/31 (54%) Query: 125 SVLFLSFYHVYLSFVMRKFRDKKLFHSPKYF 155 LF+ F + FV R R+K+ ++S K F Sbjct: 89 DALFIPFKELCNHFVERVRRNKRSYYSGKNF 119 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.338 0.148 0.471 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 113,439 Number of Sequences: 1233 Number of extensions: 4462 Number of successful extensions: 26 Number of sequences better than 100.0: 12 Number of HSP's better than 100.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 14 Number of HSP's gapped (non-prelim): 15 length of query: 178 length of database: 328,796 effective HSP length: 68 effective length of query: 110 effective length of database: 244,952 effective search space: 26944720 effective search space used: 26944720 T: 11 A: 40 X1: 15 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.8 bits) S2: 35 (18.1 bits)