RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780813|ref|YP_003065226.1| Maf-like protein [Candidatus Liberibacter asiaticus str. psy62] (199 letters) >gnl|CDD|30773 COG0424, Maf, Nucleotide-binding protein implicated in inhibition of septum formation [Cell division and chromosome partitioning]. Length = 193 Score = 163 bits (415), Expect = 2e-41 Identities = 67/200 (33%), Positives = 104/200 (52%), Gaps = 10/200 (5%) Query: 1 MIKNIILASSSLSRRKLLQNSGIQFSVVKPNIDEREMEKKMDFSERKRPEKIALILAEKK 60 M+ +ILASSS RR+LL+ GI F V+ +IDE + + P + L LAE+K Sbjct: 1 MMPRLILASSSPRRRELLEQLGIPFEVIPSDIDE-------PLLKAEEPREYVLRLAEEK 53 Query: 61 ALEVSNRYP-ESFVIGCDQTMSLGSSIYHKPVDMLEAEKNLLRISGKKHRISSAYVLVQN 119 A V+ R P ++ VIG D + L I KP D EA + L ++SG+ H++ + L+ Sbjct: 54 ARAVAARLPPDALVIGADTVVVLDGRILGKPKDEEEAREMLRKLSGRTHQVYTGVALIDP 113 Query: 120 GKVLRHHISVAQLTMYKLSEEFIKFYLNKIGKKALLSVGSYQIDKEGIQLFSSIKGSYFS 179 GK ++ + V ++ LS+E I+ Y+ L G+Y I G I+G Y + Sbjct: 114 GKRVQSEVEVTKVRFRTLSDEEIEAYVASGE--PLDKAGAYGIQGLGGLFIEKIEGDYSN 171 Query: 180 IVGLPIIELINDLKIEKVID 199 +VGLP+ EL+ L+ Sbjct: 172 VVGLPLPELVQLLRELGFSV 191 >gnl|CDD|29954 cd00555, Maf, Nucleotide binding protein Maf. Maf has been implicated in inhibition of septum formation in eukaryotes, bacteria and archaea, but homologs in B.subtilis and S.cerevisiae are nonessential for cell division. Maf has been predicted to be a nucleotide- or nucleic acid-binding protein with structural similarity to the hypoxanthine/xanthine NTP pyrophosphatase Ham1 from Methanococcus jannaschii, RNase H from Escherichia coli, and some other nucleotide or RNA-binding proteins.. Length = 180 Score = 162 bits (413), Expect = 4e-41 Identities = 68/189 (35%), Positives = 100/189 (52%), Gaps = 10/189 (5%) Query: 5 IILASSSLSRRKLLQNSGIQFSVVKPNIDEREMEKKMDFSERKRPEKIALILAEKKALEV 64 +ILAS+S RR+LL+ GI F VV +IDE ++ + PE L LAE KA V Sbjct: 1 LILASASPRRRELLEQLGIPFEVVPSDIDETPIKGES-------PEDYVLRLAEAKAEAV 53 Query: 65 SNRYP-ESFVIGCDQTMSLGSSIYHKPVDMLEAEKNLLRISGKKHRISSAYVLVQNGKVL 123 + R P ++ VIG D + L I KP D EA + L R+SG+ H + + L+ G L Sbjct: 54 AARLPPDALVIGADTVVVLDGRILGKPKDREEAREMLKRLSGRTHEVYTGVALIDPGGKL 113 Query: 124 RHHISVAQLTMYKLSEEFIKFYLNKIGKKALLSVGSYQIDKEGIQLFSSIKGSYFSIVGL 183 + ++ +LS+E I+ Y+ + L G+Y I G L I+G Y ++VGL Sbjct: 114 VTDVESTKVRFRELSDEEIEAYVAS--GEPLDKAGAYGIQGLGGALIERIEGDYSNVVGL 171 Query: 184 PIIELINDL 192 P+ EL+ L Sbjct: 172 PLPELLKLL 180 >gnl|CDD|111445 pfam02545, Maf, Maf-like protein. Maf is a putative inhibitor of septum formation in eukaryotes, bacteria, and archaea. Length = 193 Score = 106 bits (267), Expect = 4e-24 Identities = 61/191 (31%), Positives = 98/191 (51%), Gaps = 11/191 (5%) Query: 5 IILASSSLSRRKLLQNSGIQFSVVKPNIDEREMEKKMDFSERKRPEKIALILAEKKALE- 63 +ILAS+S R++LL++ GI F V+ DE + +D P + + LA +KAL Sbjct: 3 LILASTSPRRKELLEDLGIPFEVIVSYFDEESVLYSLD------PREYVVDLACEKALAK 56 Query: 64 VSNRYP-ESFVIGCDQTMSLGSSIYHKPVDMLEAEKNLLRISGKKHRISSAYVLVQNGKV 122 V+ P + +IG D + LG I KP D EA + L ++SG H + + L+ K Sbjct: 57 VAQLAPDNALIIGADTVVILGGRILGKPKDKEEAREMLRKLSGNVHSVYTGLALISPEKN 116 Query: 123 LRHHISVAQLTMYKLSEEFIKFYLNKIGKKALLSVGSYQIDKEGIQLFSSIKGSYFSIVG 182 L V ++ LS+E I+ Y+ + L G+Y I G I+G Y+++VG Sbjct: 117 LLFL-EVTKVKFRDLSDEEIEAYVES--GEPLDKAGAYGIQGFGGLFIKKIEGDYYNVVG 173 Query: 183 LPIIELINDLK 193 LP+ +L + L+ Sbjct: 174 LPLPKLRSLLR 184 >gnl|CDD|73242 cd00985, Maf_Ham1, Maf_Ham1. Maf, a nucleotide binding protein, has been implicated in inhibition of septum formation in eukaryotes, bacteria and archaea. A Ham1-related protein from Methanococcus jannaschii is a novel NTPase that has been shown to hydrolyze nonstandard nucleotides, such as hypoxanthine/xanthine NTP, but not standard nucleotides.. Length = 131 Score = 89.1 bits (221), Expect = 7e-19 Identities = 36/131 (27%), Positives = 55/131 (41%), Gaps = 9/131 (6%) Query: 5 IILASSSLSRRKLLQNSG-IQFSVVKPNIDEREMEKKMDFSERKRPEKIALILAEKKALE 63 +ILAS S R + L+ G I+F V+ +IDE + PE LA KA Sbjct: 1 LILASGSPRRLEELKQIGGIEFEVLPSDIDET--------GLKGEPEDTVEELALLKARA 52 Query: 64 VSNRYPESFVIGCDQTMSLGSSIYHKPVDMLEAEKNLLRISGKKHRISSAYVLVQNGKVL 123 V+ R P++ VI D + + KP EA + L +SG+ +A LV + Sbjct: 53 VAERLPDAPVIADDTGLVVDGRPGGKPARFAEALEMLRGLSGRTAEFVTAVALVDPDGKI 112 Query: 124 RHHISVAQLTM 134 + + Sbjct: 113 ITFEGETEGKI 123 >gnl|CDD|36722 KOG1509, KOG1509, KOG1509, Predicted nucleic acid-binding protein ASMTL [Cell cycle control, cell division, chromosome partitioning]. Length = 209 Score = 75.4 bits (185), Expect = 9e-15 Identities = 57/195 (29%), Positives = 92/195 (47%), Gaps = 21/195 (10%) Query: 3 KNIILASSSLSRRKLLQNSGIQFSVVKPNIDEREMEKKMDFSERKRPEKIALILAEKKAL 62 K IILAS+S R+++L G+ VV +E + S + PE + A++KA Sbjct: 10 KRIILASASPRRKQILAEMGLNLEVVVSTFEE-----NLIKSSFETPEDYVVETAKQKAE 64 Query: 63 EVSNRYPE------SFVIGCDQTMSLGSSIYHKPVDMLEAEKNLLRISGKKHRISSA--- 113 E+ R + VI D + G IY KPVD +A++ L R+SG+ H + + Sbjct: 65 EIIERLGDGEDSFPDVVISADTITTDGGEIYEKPVDKKDAKRMLKRLSGRPHSVFTGVAL 124 Query: 114 -YVLVQNGKVLRHHISVAQLTMYKLSEEFIKFYLNK--IGKKALLSVGSYQIDKEGIQLF 170 + Q G + ++ ++ EE I+ Y++ KKA G Y I G L Sbjct: 125 IHCSSQLGTRVSEFYDETKVYFGEIPEEVIEEYVDSGEPLKKA----GGYGIQGLGAPLI 180 Query: 171 SSIKGSYFSIVGLPI 185 S+ G + ++VGLP+ Sbjct: 181 ESVVGDFDNVVGLPL 195 >gnl|CDD|38432 KOG3222, KOG3222, KOG3222, Inosine triphosphate pyrophosphatase [Nucleotide transport and metabolism]. Length = 195 Score = 29.9 bits (67), Expect = 0.45 Identities = 16/72 (22%), Positives = 36/72 (50%), Gaps = 3/72 (4%) Query: 86 IYHKPVDMLEAEKNLLRISGKKHRISSAYVLVQNGKVLRHHISVAQLTMYKLSEEFIKFY 145 + + +D+ E + + I+ +K ++++ V G VL S+ + L +IK++ Sbjct: 33 LINIDLDLPEIQGSPEEIAIEKCKVAAEIV---KGPVLVEDTSLCFNALGGLPGPYIKWF 89 Query: 146 LNKIGKKALLSV 157 L K+G + L + Sbjct: 90 LKKLGPEGLHEM 101 >gnl|CDD|34720 COG5118, BDP1, Transcription initiation factor TFIIIB, Bdp1 subunit [Transcription]. Length = 507 Score = 28.2 bits (62), Expect = 1.6 Identities = 16/48 (33%), Positives = 25/48 (52%), Gaps = 3/48 (6%) Query: 16 KLLQNSGIQFSVVK---PNIDEREMEKKMDFSERKRPEKIALILAEKK 60 K L G FS++ PN + ++++ K E+ PE+I L EKK Sbjct: 378 KALSIWGTDFSLISSLFPNRERKQIKAKFIKEEKVNPERINEALNEKK 425 >gnl|CDD|38860 KOG3655, KOG3655, KOG3655, Drebrins and related actin binding proteins [Cytoskeleton]. Length = 484 Score = 26.5 bits (58), Expect = 5.5 Identities = 13/38 (34%), Positives = 18/38 (47%) Query: 33 DEREMEKKMDFSERKRPEKIALILAEKKALEVSNRYPE 70 +E EKK ERK+ E+ E++ E RY E Sbjct: 190 LRQEEEKKKAEDERKQFEQERREREEEEHKERERRYQE 227 >gnl|CDD|119350 cd02871, GH18_chitinase_D-like, GH18 domain of Chitinase D (ChiD). ChiD, a chitinase found in Bacillus circulans, hydrolyzes the 1,4-beta-linkages of N-acetylglucosamine in chitin and chitodextrins. The domain architecture of ChiD includes a catalytic glycosyl hydrolase family 18 (GH18) domain, a chitin-binding domain, and a fibronectin type III domain. The chitin-binding and fibronectin type III domains are located either N-terminal or C-terminal to the catalytic domain. This family includes exochitinase Chi36 from Bacillus cereus.. Length = 312 Score = 26.1 bits (58), Expect = 6.7 Identities = 9/22 (40%), Positives = 11/22 (50%), Gaps = 2/22 (9%) Query: 139 EEFIKF--YLNKIGKKALLSVG 158 EF L GKK L+S+G Sbjct: 60 AEFKADIKALQAKGKKVLISIG 81 >gnl|CDD|34758 COG5157, CDC73, RNA polymerase II assessory factor [Transcription]. Length = 362 Score = 25.5 bits (55), Expect = 8.9 Identities = 12/40 (30%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Query: 158 GSYQIDKEGIQLFSSIKGSYFSIVGLPIIELINDLKIEKV 197 G Y G +LF++IKG YF+ G + + +E++ Sbjct: 293 GRYNWRDPG-ELFNTIKGFYFARRGDQSNLYMRNWNVEEI 331 >gnl|CDD|100023 cd06059, Tubulin, The tubulin superfamily includes five distinct families, the alpha-, beta-, gamma-, delta-, and epsilon-tubulins and a sixth family (zeta-tubulin) which is present only in kinetoplastid protozoa. The alpha- and beta-tubulins are the major components of microtubules, while gamma-tubulin plays a major role in the nucleation of microtubule assembly. The delta- and epsilon-tubulins are widespread but unlike the alpha, beta, and gamma-tubulins they are not ubiquitous among eukaryotes. The alpha/beta-tubulin heterodimer is the structural subunit of microtubules. The alpha- and beta-tubulins share 40% amino-acid sequence identity, exist in several isotype forms, and undergo a variety of posttranslational modifications. The structures of alpha- and beta-tubulin are basically identical: each monomer is formed by a core of two beta-sheets surrounded by alpha-helices. The monomer structure is very compact, but can be divided into three regions based on function: the amino-terminal nucleotide-binding region, an intermediate taxol-binding region and the carboxy-terminal region which probably constitutes the binding surface for motor proteins. Also included in this group is the mitochondrial Misato/DML1 protein family, involved in mitochondrial fusion and in mitochondrial distribution and morphology.. Length = 382 Score = 25.7 bits (57), Expect = 9.1 Identities = 11/36 (30%), Positives = 21/36 (58%), Gaps = 4/36 (11%) Query: 160 YQIDK----EGIQLFSSIKGSYFSIVGLPIIELIND 191 Q++K +G Q+ S+ G S +G ++EL++D Sbjct: 81 KQVEKCDSLQGFQITHSLGGGTGSGLGSLLLELLSD 116 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.318 0.135 0.361 Gapped Lambda K H 0.267 0.0608 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 2,232,679 Number of extensions: 111794 Number of successful extensions: 290 Number of sequences better than 10.0: 1 Number of HSP's gapped: 278 Number of HSP's successfully gapped: 18 Length of query: 199 Length of database: 6,263,737 Length adjustment: 89 Effective length of query: 110 Effective length of database: 4,340,536 Effective search space: 477458960 Effective search space used: 477458960 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 55 (25.2 bits)