>cd00822 TopoII_Trans_DNA_gyrase TopoIIA_Trans_DNA_gyrase: Transducer domain, having a ribosomal S5 domain 2-like fold, of the type found in proteins of the type IIA family of DNA topoisomerases similar to the B subunits of E. coli DNA gyrase and E. coli Topoisomerase IV which are heterodimers composed of two subunits. The type IIA enzymes are the predominant form of topoisomerase and are found in some bacteriophages, viruses and archaea, and in all bacteria and eukaryotes. All type IIA topoisomerases are related to each other at amino acid sequence level, though their oligomeric organization sometimes differs. TopoIIA enzymes cut both strands of the duplex DNA to remove (relax) both positive and negative supercoils in DNA. These enzymes covalently attach to the 5' ends of the cut DNA, separate the free ends of the cleaved strands, pass another region of the duplex through this gap, then rejoin the ends. TopoIIA enzymes also catenate/ decatenate duplex rings. E.coli DNA gyrase is a

Probab=100.00 E-value=0 Score=391.64 Aligned_cols=172 Identities=50% Similarity=0.866 Sum_probs=168.9 Q ss_pred CCCHHHHHHHCCCCCCCCCCCEEEEEEEEEEEEEEEEEECCCCCCEEEEEECCCCCCCCCCEEHHHHHHHHHHHHHHHHH Q ss_conf 88357765300356556885203642003699973345317754121222246216667721035688899999999986 Q gi|254780814|r 227 GGIEAFVSYLDRHKKPLMQSPIRIQGSRDNISIDLAMRWNDGYHENVLCFTNNIPQKDGGTHLSGLRSALTRQITSYVEK 306 (803) Q Consensus 227 ~Gi~~fv~~l~~~~~~~~~~~i~~~~~~~~~~veval~~~~~~~e~i~SfvN~I~T~~GGtHv~gf~~al~~~i~~y~~~ 306 (803) T Consensus 1 gGi~dfv~~l~~~k~~l~~~~i~~~~~~~~~~vEvA~qw~~~~~e~i~sf~N~I~T~~GGTH~~Gfk~altr~i~~y~~~ 80 (172) T cd00822 1 GGLKDFVEELNKDKEPLHEEPIYIEGEKDGVEVEVALQWTDSYSENILSFVNNIPTPEGGTHETGFRAALTRAINDYAKK 80 (172) T ss_pred CCHHHHHHHHHCCCCCCCCCCEEEEEEECCEEEEEEEEECCCCCCEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHH T ss_conf 98899999984699858899979998748989999998358888607860668467999852789999999999999998 Q ss_pred CCCCCCCCCCCCHHHHHCCCEEEEEEECCCCCCCCCCHHHHCCCCCCHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 24200012357613430572156665213763357210020261111032111026899998740035799987789998 Q gi|254780814|r 307 SFGSKKDKRSVIGDDCREGFTSVLSIKMPDPRFSSQTKEKLVSSEVRSVVESFVNDGLSAWLEEHPLEAKIIVKKVLDAS 386 (803) Q Consensus 307 ~~~~Kk~k~~~~~~Diregl~~visvki~nP~F~gQTK~kL~s~~v~~~v~~~v~~~l~~~l~~n~~~ak~i~~k~~~a~ 386 (803) T Consensus 81 ~~l~k~~~~~~~~dDi~egl~~iiSvki~~PqFegQTK~KL~s~ev~~~v~~~v~~~l~~~l~~np~~a~~Ii~k~i~~a 160 (172) T cd00822 81 NNLLKKKDVKLTGDDIREGLTAVISVKVPEPQFEGQTKDKLGNSEVRSIVESAVREALEEWLEENPEEAKKILEKAILAA 160 (172) T ss_pred HCCCCCCCCCCCHHHHHCCCEEEEEECCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHH T ss_conf 25023354789999996436488552536882266220521788899999999999999999989999999999999999 Q ss_pred HHHHHHHHHHHH Q ss_conf 877554553211 Q gi|254780814|r 387 MVRDAARRARDL 398 (803) Q Consensus 387 ~ar~~a~kar~~ 398 (803) T Consensus 161 ~aR~~akkare~ 172 (172) T cd00822 161 KAREAARKAREL 172 (172) T ss_pred HHHHHHHHHCCC T ss_conf 999999973479

HHsearch alignment for GI: 254780814 and conserved domain: cd00822