RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780815|ref|YP_003065228.1| hypothetical protein CLIBASIA_03530 [Candidatus Liberibacter asiaticus str. psy62] (232 letters) >gnl|CDD|178148 PLN02533, PLN02533, probable purple acid phosphatase. Length = 427 Score = 31.6 bits (71), Expect = 0.16 Identities = 15/30 (50%), Positives = 17/30 (56%), Gaps = 2/30 (6%) Query: 111 YEAIVDSFFEGKVHAIEKLVDSRVYQDFND 140 Y+A VD F G VHA E+ RVYQ D Sbjct: 319 YKARVDLVFAGHVHAYERF--DRVYQGKTD 346 >gnl|CDD|178518 PLN02930, PLN02930, CDP-diacylglycerol-serine O-phosphatidyltransferase. Length = 353 Score = 28.6 bits (64), Expect = 1.4 Identities = 20/66 (30%), Positives = 26/66 (39%), Gaps = 16/66 (24%) Query: 179 RIVGQFISASYDKDNLLISSDPEIFGKVIDI-------------WTFVRNIPPSNPNWVL 225 R +GQF A +DKD P F +V+ + F IPP NP L Sbjct: 236 RTLGQFTPAQWDKDEWHPLQGPWRFLQVLFLCVVFLTVELNTFFLKFCLWIPPRNP---L 292 Query: 226 ISTKLG 231 I +L Sbjct: 293 IVYRLI 298 >gnl|CDD|183556 PRK12493, PRK12493, magnesium chelatase subunit H; Provisional. Length = 1310 Score = 28.0 bits (63), Expect = 1.9 Identities = 13/43 (30%), Positives = 20/43 (46%), Gaps = 14/43 (32%) Query: 111 YEAIVDSFFEGKVHAIEK-------------LVDSRVYQDFND 140 YE ++ +EG V IEK VD+ VY++ N+ Sbjct: 1205 YEGMLKHGYEG-VREIEKRLNNTYGWSATAGAVDNWVYEEVNE 1246 >gnl|CDD|151059 pfam10499, Pmp24, Peroxisomal membrane protein 24. Peroxisomes are single membrane bound organelles, present in practically all eukaryotic cells, and involved in a variety of metabolic pathways; the deduced protein is extremely basic, a characteristic of many other peroxisomal intrinsic membrane proteins. They carry two short stretches of hydrophobic residues shown to be necessary for the correct targeting of these proteins. A sequence with these characteristics is found in human PMP24 (amino acid residues 16-30). However, in the absence of experimental data, the involvement of this domain in the targeting of PMP24 remains to be proved. PMP24 was known as Pmp27. Length = 181 Score = 27.6 bits (62), Expect = 2.5 Identities = 16/40 (40%), Positives = 20/40 (50%), Gaps = 1/40 (2%) Query: 16 FAFITFFVFLQLRGVLGKKTGN-EKPFSGFFSGKYVFSKR 54 FAFI + L LR + G K G +GF G VF +R Sbjct: 56 FAFIYKSLRLLLRNLGGGKEGGWHSFLAGFLGGYLVFGER 95 >gnl|CDD|178951 PRK00260, cysS, cysteinyl-tRNA synthetase; Validated. Length = 463 Score = 27.4 bits (62), Expect = 3.6 Identities = 12/35 (34%), Positives = 21/35 (60%), Gaps = 6/35 (17%) Query: 159 IDDMKIINASIEENTVYITIR-IVGQFISASYDKD 192 IDD KII + EE +I+ + ++I A++ +D Sbjct: 71 IDD-KIIKRANEEG---ESIKELTERYI-AAFHED 100 >gnl|CDD|180265 PRK05802, PRK05802, hypothetical protein; Provisional. Length = 320 Score = 27.2 bits (61), Expect = 4.0 Identities = 11/38 (28%), Positives = 19/38 (50%), Gaps = 3/38 (7%) Query: 162 MKIINASIEENTVYITIRIVG---QFISASYDKDNLLI 196 + I+ A EEN + + I I G + I+ D +L+ Sbjct: 116 ISIMEADTEENIIKVAIEIRGVKTKKIAKLNKGDEILL 153 >gnl|CDD|184029 PRK13399, PRK13399, fructose-1,6-bisphosphate aldolase; Provisional. Length = 347 Score = 27.1 bits (60), Expect = 4.5 Identities = 20/65 (30%), Positives = 31/65 (47%), Gaps = 7/65 (10%) Query: 56 ERGIITLGKGKKKDNLDSINELFPIGTRLNKVMRDIVSVYTDFDPKDFLNEARNSYEAIV 115 +RGI G +K N+D+ L G + KV+ + S +FDP+ L A + A+ Sbjct: 264 QRGI---KHGVRKVNIDTDIRLAMTG-AIRKVLAEHPS---EFDPRKALKPAMKAMTALC 316 Query: 116 DSFFE 120 FE Sbjct: 317 KQRFE 321 >gnl|CDD|185477 PTZ00144, PTZ00144, dihydrolipoamide succinyltransferase; Provisional. Length = 418 Score = 26.6 bits (59), Expect = 6.4 Identities = 10/33 (30%), Positives = 19/33 (57%), Gaps = 4/33 (12%) Query: 152 VKSSLVGIDDMKIINASIEENTV----YITIRI 180 VK+S + + M I+NA I+ + + Y+ I + Sbjct: 252 VKASTIALKKMPIVNAYIDGDEIVYRNYVDISV 284 >gnl|CDD|161909 TIGR00513, accA, acetyl-CoA carboxylase, carboxyl transferase, alpha subunit. The enzyme acetyl-CoA carboxylase contains a biotin carboxyl carrier protein or domain, a biotin carboxylase, and a carboxyl transferase. This model represents the alpha chain of the carboxyl transferase for cases in which the architecture of the protein is as in E. coli, in which the carboxyltransferase portion consists of two non-identical subnits, alpha and beta. Length = 316 Score = 26.3 bits (58), Expect = 6.9 Identities = 16/73 (21%), Positives = 30/73 (41%), Gaps = 11/73 (15%) Query: 56 ERGIITLGKGKKKDNLDSINELFPIGTRLNKVMRDIVSVYTDFDPKDFLNEARNS----- 110 E I +L + +++D E+ + R ++ + I +++ L AR+ Sbjct: 16 EAKIESLRARSRDEDVDLSEEIERLEKRSVELTKKI---FSNLGAWQRLQLARHPDRPYT 72 Query: 111 ---YEAIVDSFFE 120 E I D FFE Sbjct: 73 LDYIELIFDDFFE 85 >gnl|CDD|179539 PRK03103, PRK03103, DNA polymerase IV; Reviewed. Length = 409 Score = 26.1 bits (58), Expect = 8.0 Identities = 12/46 (26%), Positives = 26/46 (56%), Gaps = 10/46 (21%) Query: 51 FSKRDERGIITLGKGKKKDNLDS------INELFPIGTRLNKVMRD 90 F+K++ G+ TL K+++ + + +LF +G+R+ K +R Sbjct: 158 FAKKNPDGLFTL----DKEDVPADLWPLPVRKLFGVGSRMEKHLRR 199 >gnl|CDD|148010 pfam06148, COG2, COG (conserved oligomeric Golgi) complex component, COG2. The COG complex comprises eight proteins COG1-8. The COG complex plays critical roles in Golgi structure and function. The proposed function of the complex is to mediate the initial physical contact between transport vesicles and their membrane targets. A comparable role in tethering vesicles has been suggested for at least six additional large multisubunit complexes, including the exocyst, a complex that mediates trafficking to the plasma membrane. COG2 structure reveals a six-helix bundle with few conserved surface features but a general resemblance to recently determined crystal structures of four different exocyst subunits. These bundles inCOG2 may act as platforms for interaction with other trafficing proteins including SNAREs (soluble N-ethylmaleimide factor attachment protein receptors) and Rabs. Length = 133 Score = 26.1 bits (58), Expect = 8.6 Identities = 22/77 (28%), Positives = 33/77 (42%), Gaps = 31/77 (40%) Query: 97 DFDPKDFLNEARN------------SYEAIVDSFFEGKVHAIEKLVDSRVYQDFNDSLST 144 DFDP FL+E R +Y ++ S + +L++ Y DF SLST Sbjct: 12 DFDPDQFLSELRKGVPLESLRDDLRAYLKLLKS-------ELIELINED-YADFV-SLST 62 Query: 145 RKSNEKNVKSSLVGIDD 161 +LVG+D+ Sbjct: 63 ----------NLVGLDE 69 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.321 0.140 0.401 Gapped Lambda K H 0.267 0.0590 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 3,808,050 Number of extensions: 244697 Number of successful extensions: 528 Number of sequences better than 10.0: 1 Number of HSP's gapped: 527 Number of HSP's successfully gapped: 23 Length of query: 232 Length of database: 5,994,473 Length adjustment: 90 Effective length of query: 142 Effective length of database: 4,049,753 Effective search space: 575064926 Effective search space used: 575064926 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 55 (25.3 bits)