Query         gi|254780816|ref|YP_003065229.1| hypothetical protein CLIBASIA_03535 [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 63
No_of_seqs    1 out of 3
Neff          1.0 
Searched_HMMs 13730
Date          Wed Jun  1 05:54:06 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780816.hhm -d /home/congqian_1/database/scop/scop70_1_75.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 d1i7na1 c.30.1.5 (A:113-214) S  10.8      36  0.0026   14.0   0.7   43   10-52     18-65  (102)
  2 d2b5ua2 b.110.1.1 (A:84-315) C  10.6      31  0.0022   14.3   0.4   22   25-53    196-217 (232)
  3 d1sjda1 c.1.11.2 (A:126-367) N  10.3      53  0.0039   13.0   1.5   10   26-35      4-13  (242)
  4 d1wuea1 c.1.11.2 (A:1127-1367)   8.8      52  0.0038   13.0   0.9   10   26-35      4-13  (241)
  5 d1wufa1 c.1.11.2 (A:1127-1370)   7.4      68  0.0049   12.4   1.0   11   25-35      3-13  (244)
  6 d2p8ia1 d.58.55.1 (A:1-115) Pu   5.7      88  0.0064   11.7   1.7   13    3-15     10-22  (115)
  7 d1hn0a3 b.24.1.1 (A:900-1021)    5.0      97  0.0071   11.5   2.0   26   17-42     23-48  (122)
  8 d1vcla3 d.281.1.1 (A:284-432)    4.2 1.1E+02  0.0082   11.1   2.5   22   34-55     94-118 (149)
  9 d1xhca3 d.87.1.1 (A:290-351) N   3.0 1.5E+02   0.011   10.5   1.3   15   13-27      9-23  (62)
 10 d1vcaa2 b.1.1.4 (A:1-90) Vascu   2.3 1.8E+02   0.013    9.9   2.0   40   20-59      1-41  (90)

No 1  
>d1i7na1 c.30.1.5 (A:113-214) Synapsin II {Rat (Rattus norvegicus) [TaxId: 10116]}
Probab=10.79  E-value=36  Score=13.96  Aligned_cols=43  Identities=19%  Similarity=0.346  Sum_probs=25.2

Q ss_pred             EEEECCEEEEEEEEEE-----EEEEEEEECCEEEEEEEEEEEHHHHHH
Q ss_conf             9961220335566765-----457889844278999999741023456
Q gi|254780816|r   10 YFQRKSIFNLFKISIA-----TIPVYISIGKACMIQIQILETEQKDQR   52 (63)
Q Consensus        10 yfqrksifnlfkisia-----tipvyisigkacmiqiqileteqkdqr   52 (63)
                      ||.-|.++.-+.|.+.     .|.+--.-...||+.+|++....|.-|
T Consensus        18 yFrgkki~g~ydIrVEQAeFseinl~a~s~~g~~Vd~~v~r~gtkvvR   65 (102)
T d1i7na1          18 CFRGKKILGDYDIKVEQAEFSELNLVAHADGTYAVDMQVLRNGTKVVR   65 (102)
T ss_dssp             HHTTCEETTTEEEEEEEECGGGEEEEEETTSCEEEEEEECSSSSSEEE
T ss_pred             HHCCCCCCCCEEEEEEEECCEEEEEEEECCCCEEEEEEEECCCCEEEE
T ss_conf             727882178378999885110579999728976999995228851555


No 2  
>d2b5ua2 b.110.1.1 (A:84-315) Colicin E3 N-terminal domain {Escherichia coli [TaxId: 562]}
Probab=10.64  E-value=31  Score=14.32  Aligned_cols=22  Identities=32%  Similarity=0.530  Sum_probs=13.9

Q ss_pred             EEEEEEEEECCEEEEEEEEEEEHHHHHHH
Q ss_conf             54578898442789999997410234565
Q gi|254780816|r   25 ATIPVYISIGKACMIQIQILETEQKDQRW   53 (63)
Q Consensus        25 atipvyisigkacmiqiqileteqkdqrw   53 (63)
                      ..-|+|+|.+       .+|.++|-.||-
T Consensus       196 Gl~PvYVs~~-------~~l~s~~~~r~q  217 (232)
T d2b5ua2         196 GHNAVYVSVS-------DVLSPDQVKQRQ  217 (232)
T ss_dssp             CCCCEEEEEE-------ECCCHHHHHHHH
T ss_pred             CCCCEEEEEC-------CCCCHHHHHHHH
T ss_conf             9997799941-------569889988999


No 3  
>d1sjda1 c.1.11.2 (A:126-367) N-acylamino acid racemase {Amycolatopsis sp. [TaxId: 37632]}
Probab=10.26  E-value=53  Score=12.96  Aligned_cols=10  Identities=30%  Similarity=0.703  Sum_probs=7.7

Q ss_pred             EEEEEEEECC
Q ss_conf             4578898442
Q gi|254780816|r   26 TIPVYISIGK   35 (63)
Q Consensus        26 tipvyisigk   35 (63)
                      .||||.|+|-
T Consensus         4 ~ipvy~s~g~   13 (242)
T d1sjda1           4 SVPCGVSVGI   13 (242)
T ss_dssp             EEEBEEEECC
T ss_pred             EEEEEEEECC
T ss_conf             2684489579


No 4  
>d1wuea1 c.1.11.2 (A:1127-1367) N-acylamino acid racemase {Enterococcus faecalis [TaxId: 1351]}
Probab=8.77  E-value=52  Score=13.03  Aligned_cols=10  Identities=60%  Similarity=0.820  Sum_probs=7.5

Q ss_pred             EEEEEEEECC
Q ss_conf             4578898442
Q gi|254780816|r   26 TIPVYISIGK   35 (63)
Q Consensus        26 tipvyisigk   35 (63)
                      .||||+|+|-
T Consensus         4 ~ipv~~s~g~   13 (241)
T d1wuea1           4 KIPVGISLGI   13 (241)
T ss_dssp             EEECCEEECC
T ss_pred             EEEEEEEECC
T ss_conf             7999899478


No 5  
>d1wufa1 c.1.11.2 (A:1127-1370) N-acylamino acid racemase {Listeria innocua [TaxId: 1642]}
Probab=7.42  E-value=68  Score=12.37  Aligned_cols=11  Identities=45%  Similarity=0.549  Sum_probs=7.7

Q ss_pred             EEEEEEEEECC
Q ss_conf             54578898442
Q gi|254780816|r   25 ATIPVYISIGK   35 (63)
Q Consensus        25 atipvyisigk   35 (63)
                      ..||||.|+|-
T Consensus         3 ~~i~~~~s~g~   13 (244)
T d1wufa1           3 ESIKVGVSIGL   13 (244)
T ss_dssp             SEEEBCEEECC
T ss_pred             CEEEEEEEECC
T ss_conf             76887379478


No 6  
>d2p8ia1 d.58.55.1 (A:1-115) Putative dioxygenase BxeB0224 {Burkholderia xenovorans [TaxId: 36873]}
Probab=5.66  E-value=88  Score=11.71  Aligned_cols=13  Identities=38%  Similarity=0.723  Sum_probs=9.2

Q ss_pred             EEEEEEEEEEECC
Q ss_conf             4898999996122
Q gi|254780816|r    3 EIFEIHVYFQRKS   15 (63)
Q Consensus         3 eifeihvyfqrks   15 (63)
                      .-|..||||...|
T Consensus        10 ~~yhaHVYfd~~~   22 (115)
T d2p8ia1          10 ASWHAHVYFDASS   22 (115)
T ss_dssp             CEEEEEEEECGGG
T ss_pred             CCEEEEEECCCCC
T ss_conf             6568899889778


No 7  
>d1hn0a3 b.24.1.1 (A:900-1021) Chondroitin ABC lyase I {Proteus vulgaris [TaxId: 585]}
Probab=5.03  E-value=97  Score=11.47  Aligned_cols=26  Identities=4%  Similarity=0.158  Sum_probs=18.6

Q ss_pred             EEEEEEEEEEEEEEEEECCEEEEEEE
Q ss_conf             33556676545788984427899999
Q gi|254780816|r   17 FNLFKISIATIPVYISIGKACMIQIQ   42 (63)
Q Consensus        17 fnlfkisiatipvyisigkacmiqiq   42 (63)
                      +|.|+-.-.+....++..+.||+.++
T Consensus        23 ~~f~~~~~~~~g~i~~~d~p~~Vm~~   48 (122)
T d1hn0a3          23 YAFYQPASIEDKWIKKVNKPAIVMTH   48 (122)
T ss_dssp             EEESSCEECCCSSEEEESSSEEEEEE
T ss_pred             EEEECCCCCCCCEEEECCCCEEEEEE
T ss_conf             99971777677738983882499999


No 8  
>d1vcla3 d.281.1.1 (A:284-432) Hemolytic lectin CEL-III, C-terminal domain {Cucumaria echinata [TaxId: 40245]}
Probab=4.20  E-value=1.1e+02  Score=11.11  Aligned_cols=22  Identities=36%  Similarity=0.640  Sum_probs=16.7

Q ss_pred             CCEEEEEEEEEEEHHHHH---HHHC
Q ss_conf             427899999974102345---6531
Q gi|254780816|r   34 GKACMIQIQILETEQKDQ---RWKK   55 (63)
Q Consensus        34 gkacmiqiqileteqkdq---rwkk   55 (63)
                      -..||-|+.+-.+|++..   ||..
T Consensus        94 ~rgcmwql~v~t~e~~a~~~m~w~p  118 (149)
T d1vcla3          94 TRGCMWQLAIETTEVKSGDLLVWNP  118 (149)
T ss_dssp             SSEEEEEEEEEEEETTTTEEEEEEC
T ss_pred             HHCEEEEEEEEEEEECCCCEEECCC
T ss_conf             1031589998763011575123165


No 9  
>d1xhca3 d.87.1.1 (A:290-351) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]}
Probab=3.00  E-value=1.5e+02  Score=10.46  Aligned_cols=15  Identities=40%  Similarity=0.667  Sum_probs=8.3

Q ss_pred             ECCEEEEEEEEEEEE
Q ss_conf             122033556676545
Q gi|254780816|r   13 RKSIFNLFKISIATI   27 (63)
Q Consensus        13 rksifnlfkisiati   27 (63)
                      |.|+|.+-..+||-|
T Consensus         9 rSs~FKfgd~~iAii   23 (62)
T d1xhca3           9 RSTVFKFGKLQIAII   23 (62)
T ss_dssp             CEEEEEETTEEEEEE
T ss_pred             EEEEEEECCCCEEEE
T ss_conf             332131079628999


No 10 
>d1vcaa2 b.1.1.4 (A:1-90) Vascular cell adhesion molecule-1 (VCAM-1) {Human (Homo sapiens) [TaxId: 9606]}
Probab=2.27  E-value=1.8e+02  Score=9.88  Aligned_cols=40  Identities=20%  Similarity=0.364  Sum_probs=0.0

Q ss_pred             EEEEEEEEEEEEE-ECCEEEEEEEEEEEHHHHHHHHCCCCC
Q ss_conf             5667654578898-442789999997410234565314210
Q gi|254780816|r   20 FKISIATIPVYIS-IGKACMIQIQILETEQKDQRWKKNKSK   59 (63)
Q Consensus        20 fkisiatipvyis-igkacmiqiqileteqkdqrwkknksk   59 (63)
                      |+|.+..-+..+. .|....+.-+.-....-.-.|.++...
T Consensus         1 f~i~i~P~~~~~~~~G~~v~l~C~~~g~p~p~i~W~~~~~~   41 (90)
T d1vcaa2           1 FKIETTPESRYLAQIGDSVSLTCSTTGCESPFFSWRTQIDS   41 (90)
T ss_dssp             CEEEEESSSEEEEETTSCEEEEEEEESCSSCEEEEEETTCC
T ss_pred             CEEEEECCCCEEEECCCEEEEEEECCCCCCCEEEEEECCCC
T ss_conf             98999789819997899899987615799955899724743


Done!