BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780816|ref|YP_003065229.1| hypothetical protein CLIBASIA_03535 [Candidatus Liberibacter asiaticus str. psy62] (63 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780816|ref|YP_003065229.1| hypothetical protein CLIBASIA_03535 [Candidatus Liberibacter asiaticus str. psy62] Length = 63 Score = 128 bits (322), Expect = 2e-32, Method: Compositional matrix adjust. Identities = 63/63 (100%), Positives = 63/63 (100%) Query: 1 MFEIFEIHVYFQRKSIFNLFKISIATIPVYISIGKACMIQIQILETEQKDQRWKKNKSKH 60 MFEIFEIHVYFQRKSIFNLFKISIATIPVYISIGKACMIQIQILETEQKDQRWKKNKSKH Sbjct: 1 MFEIFEIHVYFQRKSIFNLFKISIATIPVYISIGKACMIQIQILETEQKDQRWKKNKSKH 60 Query: 61 LLF 63 LLF Sbjct: 61 LLF 63 >gi|254780125|ref|YP_003064538.1| prophage antirepressor [Candidatus Liberibacter asiaticus str. psy62] Length = 262 Score = 20.8 bits (42), Expect = 4.7, Method: Composition-based stats. Identities = 7/23 (30%), Positives = 12/23 (52%) Query: 34 GKACMIQIQILETEQKDQRWKKN 56 GK C + +Q +E + +W N Sbjct: 224 GKMCDVPMQHVEGSTQQLKWNSN 246 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.331 0.141 0.418 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,661 Number of Sequences: 1233 Number of extensions: 1051 Number of successful extensions: 3 Number of sequences better than 100.0: 3 Number of HSP's better than 100.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of query: 63 length of database: 328,796 effective HSP length: 34 effective length of query: 29 effective length of database: 286,874 effective search space: 8319346 effective search space used: 8319346 T: 11 A: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 31 (16.5 bits)