RPSBLAST alignment for GI: 254780817 and conserved domain: pfam02556

>gnl|CDD|145603 pfam02556, SecB, Preprotein translocase subunit SecB. This family consists of preprotein translocase subunit SecB. SecB is required for the normal export of envelope proteins out of the cell cytoplasm. Length = 147
 Score =  163 bits (416), Expect = 1e-41
 Identities = 54/136 (39%), Positives = 87/136 (63%), Gaps = 2/136 (1%)

Query: 5   QKQAFTILNQYIKDFSFESPNAPHCFFDIQNQQPTIKINVQVNANTISGADFDVILSFDI 64
            +  F I  QY+KD SFE+PNAP  F  ++  QP + + + VNA  ++   ++V+L+  +
Sbjct: 9   PQPQFQIQRQYVKDLSFENPNAPAIF--LEEWQPEVNVQLNVNARKLAENVYEVVLTVTV 66

Query: 65  EAKNNDKVIFRLELAYSGILRILDCPQEHISQILFVECPQLLFPFVRQIISNTIRDGGFP 124
            AKN +K  F +E+  +GI  I + P+E +   L +ECP +LFP+ R+IIS+  R GGFP
Sbjct: 67  TAKNEEKTAFLVEVKQAGIFTIRNVPEEQLHPFLGIECPNILFPYAREIISDLTRRGGFP 126

Query: 125 PLVIDTIDFLKLFQQE 140
           PL++  I+F  L++Q+
Sbjct: 127 PLMLAPINFDALYEQQ 142