>cd05777 DNA_polB_delta_exo The 3'-5' exonuclease domain of eukaryotic DNA polymerase delta. DNA polymerase delta is a family-B DNA polymerase with a catalytic subunit that contains a DEDDy-type DnaQ-like 3'-5' exonuclease domain. It is one of the three DNA-dependent type B DNA polymerases (alpha and epsilon are the other two) that have been identified as essential for nuclear DNA replication in eukaryotes. DNA polymerase delta is the enzyme responsible for both elongation and maturation of Okazaki fragments on the lagging strand. It is also implicated in mismatch repair (MMR) and base excision repair (BER). The catalytic subunit displays both polymerase and 3'-5' exonuclease activities. The exonuclease domain contains three sequence motifs termed ExoI, ExoII and ExoIII, with a specific YX(3)D pattern at ExoIII. These motifs are clustered around the active site and contain four conserved acidic residues necessary for metal binding and catalysis. The exonuclease domain of family B polyme

Probab=98.33 E-value=9e-06 Score=56.05 Aligned_cols=98 Identities=18% Similarity=0.244 Sum_probs=59.0 Q ss_pred CCCEEEEECCCC---CC--CCCCCEEEEEEEEEEECCEEC--CCEEEEEECCCCCCCCHHHEEECCCCCCCCCCCCCCCH Q ss_conf 775899984678---88--888888999999999999880--31379898588822886572420210123224852100 Q gi|254780818|r 6 KMRKIVFDIETT---GL--DSKNDRIIEIGAVELLDYSKT--NRTFQVFLCPNGRKNSPEALKLHGITDEFLKDKPSFSS 78 (245) Q Consensus 6 ~mr~iv~D~ETT---Gl--~~~~d~Iieigav~i~~~~~~--~~~f~~~i~P~~~~i~~~~~~ihGIt~~~l~~~p~f~e 78 (245) T Consensus 6 plki~sfDIE~~s~~g~fP~p~~D~Ii~I~~~~~~~~~~~~~~~~v~~-l~~~-~~i~~----------~~V~~~~tE~e 73 (230) T cd05777 6 PLRILSFDIECAGRKGVFPEPEKDPVIQIANVVTRQGEGEPFIRNIFT-LKTC-APIVG----------AQVFSFETEEE 73 (230) T ss_pred CCEEEEEEEEECCCCCCCCCCCCCCEEEEEEEEEECCCCCCEEEEEEE-ECCC-CCCCC----------CEEEECCCHHH T ss_conf 804999999952699999898888348999999827977604787898-2687-88899----------87998499999 Q ss_pred HHHHHHHHHHCCC-CEEEEECC-CCCCCEEEECHHCCCC Q ss_conf 2344777530023-20231023-2243112100000112 Q gi|254780818|r 79 IFSEFWDFFNEQN-AEWIAHNA-KFDVGFINAELQRINK 115 (245) Q Consensus 79 v~~~f~~fi~~~~-~~lVaHNa-~FD~~fL~~el~r~~~ 115 (245) T Consensus 74 LL~~F~~~i~~~dPDiitGyN~~~FD~pYL~~Ra~~l~~ 112 (230) T cd05777 74 LLLAWRDFVQEVDPDIITGYNICNFDLPYLLERAKALKL 112 (230) T ss_pred HHHHHHHHHHHCCCCEEEECCCCCCCHHHHHHHHHHHCC T ss_conf 999999999980999999636667887899999999688

HHsearch alignment for GI: 254780818 and conserved domain: cd05777